gvim-9.1.1629-150500.20.38.1<>, 瘉h p9|Qg?LN/&nkQ/(hFUc8g9W)X hrAD[֔SX-AvŦo|SQSeXxq>.͔ K@3H`&KjW洋G5Eu\{?>%\1/v9l&*Q\D?Ns55/ ^hӾHs$x志Yhoz. b /Q`Ȑ\¸0wm >H~?~d  ,8<HLe Q, j  $  t  & L  4 44$(-(1889:"I>p@qBq Fq%Gq<HqIr4XrTYrZsD[sP\s]t^tbvcwjdwewfwlwuxvxw|`x|y}X:z~@~P~T~Z~Cgvim9.1.1629150500.20.38.1A GUI for ViPackage gvim contains the largest set of features of vim, which is graphical windows and language interpreter, like python, ruby, or perl. You need package vim for the help and other documentation too. If you want less features, you might want to install vim instead.h h01-ch4aJ}SUSE Linux Enterprise 15SUSE LLC Vimhttps://www.suse.com/Productivity/Text/Editorshttps://www.vim.org/linuxx86_64/usr/sbin/update-alternatives \ --install /usr/bin/vim vim /usr/bin/gvim 30 \ --slave /usr/bin/vi vi /usr/bin/gvimif [ ! -e /usr/bin/gvim ] ; then /usr/sbin/update-alternatives --remove vim /usr/bin/gvim fiH0x~)U C.&F,A큤h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h h 2e74f54bfb2dd17835dd1b10c55cb62ee9afed3fde9a6c3063e7ece95a79207c761bba80e57d7bb566bd56c4369c6777d92b54f9b77ef8a1edc3ecc4c397feeb9214a5266181ac8e4bb41475f3e1c4c9d66359d7faedf8c2a15f0cbe591a82018577b98d027a194476cf07c797319f2d26e465f43f7911c81cc9b7c4936a154e6eec36bce6a7817e62c4b15940ab1b42af19292b7ed37d42e268d2c9131b2db708795d7de0debd3ce4d8d7012d3a468d0008a470abeb5b87a46f01ffb7e3ea0b0685688fa3eabffad030fb2450faff870a4db4fb3179b4bf87b1853cb625b001d203547ea1a77a3202cceda1b017a54628250e2f0443e8d947146387145eaa09051e24f1bdf0a66bc7c3d3bb811c5229dbe789119d4dde535a1b92872090cb8f7f1c006a109948927f594b3915999ed80293e0b592a7706efafedb212411be3ca7620817e07ddab0ae17a5cb7bddeda01a42119c9863aacb48f37f1784b17f225bbc8b1988690ddf5be1c0cd1847d3128da54cfd66787308238e7825ee36988cb498011da6e6641951421a79de2e1c6ed4977d08a82afc14538e957c806d7544a8fc3d48d94761e5e255c76c7ddee31b7ef5c0cde8c919cf92a3a0c08ec58390946dce274e5051e4853cb1bf3483966bb349cd2a9e575af7e773c1ffdcaff749gvimgvimgvimgvimgvimgvimgvimgvimgvimgvim/etc/alternatives/vi/etc/alternatives/vim@@Irootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootvim-9.1.1629-150500.20.38.1.src.rpmapplication()application(gvim.desktop)config(gvim)gvimgvim(x86-64)gvim-basegvim-enhancedgvim_clientmimehandler(application/x-shellscript)mimehandler(text/english)mimehandler(text/plain)mimehandler(text/x-c)mimehandler(text/x-c++)mimehandler(text/x-c++hdr)mimehandler(text/x-c++src)mimehandler(text/x-chdr)mimehandler(text/x-csrc)mimehandler(text/x-java)mimehandler(text/x-makefile)mimehandler(text/x-moc)mimehandler(text/x-pascal)mimehandler(text/x-tcl)mimehandler(text/x-tex)vivim_client@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@    /bin/sh/bin/shconfig(gvim)gvim_clientlibICE.so.6()(64bit)libSM.so.6()(64bit)libX11.so.6()(64bit)libXt.so.6()(64bit)libacl.so.1()(64bit)libacl.so.1(ACL_1.0)(64bit)libattr.so.1()(64bit)libattr.so.1(ATTR_1.0)(64bit)libc.so.6()(64bit)libc.so.6(GLIBC_2.11)(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.15)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.28)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libc.so.6(GLIBC_2.7)(64bit)libcairo.so.2()(64bit)libdl.so.2()(64bit)libdl.so.2(GLIBC_2.2.5)(64bit)libgdk-3.so.0()(64bit)libgdk_pixbuf-2.0.so.0()(64bit)libgio-2.0.so.0()(64bit)libglib-2.0.so.0()(64bit)libgobject-2.0.so.0()(64bit)libgpm.so.2()(64bit)libgtk-3.so.0()(64bit)libm.so.6()(64bit)libm.so.6(GLIBC_2.2.5)(64bit)libm.so.6(GLIBC_2.29)(64bit)libpango-1.0.so.0()(64bit)libpangocairo-1.0.so.0()(64bit)libperl.so()(64bit)libpthread.so.0()(64bit)libpthread.so.0(GLIBC_2.2.5)(64bit)libselinux.so.1()(64bit)libselinux.so.1(LIBSELINUX_1.0)(64bit)libtinfo.so.6()(64bit)libtinfo.so.6(NCURSES6_TINFO_5.0.19991023)(64bit)libwayland-client.so.0()(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)update-alternativesupdate-alternativesvim-data9.1.1629-150500.20.38.13.0.4-14.6.0-14.0-15.2-19.1.1629-150500.20.38.1gvim8.24.14.3hh@hhQXg͂ggb@gH[@f$eqe]@dܺ@dx@dldZ5dJcd'@ccR@c~ @cM@bb@`4@`.V^)@^@^2\@Zľ@ZlZ@Z%Z1@Z@V͛@V͛@VIV@V@VVŲ@V@V@VT@VV@V@V^VVuFVm]Vd#@VQ@VO @VCV VUU6@U@U@UnU@UUUx&U_@U>$U+UUQTT!TD@TfTr@T T TT|TTxcTk4T[bTBV@martin.schreiner@suse.commartin.schreiner@suse.commartin.schreiner@suse.commartin.schreiner@suse.commartin.schreiner@suse.commartin.schreiner@suse.commartin.schreiner@suse.commartin.schreiner@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comjehan.singh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comzbalogh@suse.comlnussel@suse.delnussel@suse.delnussel@suse.deidonmez@suse.comlnussel@suse.deidonmez@suse.comstefan.bruens@rwth-aachen.dekukuk@suse.delnussel@suse.deidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comtchvatal@suse.comidonmez@suse.comnormand@linux.vnet.ibm.comsuse-beta@cboltz.deidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.commpluskal@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comwerner@suse.deidonmez@suse.comidonmez@suse.comidonmez@suse.comtchvatal@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comkukuk@suse.desuse-beta@cboltz.dekukuk@suse.deidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comdimstar@opensuse.orgidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comcrrodriguez@opensuse.orgidonmez@suse.comidonmez@suse.comidonmez@suse.comsuse-beta@cboltz.deidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comopensuse@cboltz.deidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comidonmez@suse.comlars@linux-schulserver.deidonmez@suse.comidonmez@suse.comidonmez@suse.comopensuse@cboltz.de- Fix for bsc#1250593. - Backported from 9.1.1683 (xxd: Avoid null dereference in autoskip colorless).- Fix for bsc#1229750. - nocompatible must be set before the syntax highlighting is turned on.- Fix the following CVEs and bugs: * bsc#1246602 (CVE-2025-53906) * bsc#1246604 (CVE-2025-53905) * bsc#1247939 (CVE-2025-55158) * bsc#1247938 (CVE-2025-55157) - Update to 9.1.1629: 9.1.1629: Vim9: Not able to use more than 10 type arguments in a generic function 9.1.1628: fuzzy.c has a few issues 9.1.1627: fuzzy matching can be improved 9.1.1626: cindent: does not handle compound literals 9.1.1625: Autocompletion slow with include- and tag-completion 9.1.1624: Cscope not enabled on MacOS 9.1.1623: Buffer menu does not handle unicode names correctly 9.1.1622: Patch v9.1.1432 causes performance regressions 9.1.1621: flicker in popup menu during cmdline autocompletion 9.1.1620: filetype: composer.lock and symfony.lock files not recognized 9.1.1619: Incorrect E535 error message 9.1.1618: completion: incorrect selected index returned from complete_info() 9.1.1617: Vim9: some error messages can be improved 9.1.1616: xxd: possible buffer overflow with bitwise output 9.1.1615: diff format erroneously detected 9.1.1614: Vim9: possible variable type change 9.1.1613: tests: test_search leaves a few swapfiles behind 9.1.1612: Ctrl-G/Ctrl-T do not ignore the end search delimiter 9.1.1611: possible undefined behaviour in mb_decompose() 9.1.1610: completion: hang or E684 when 'tagfunc' calls complete() 9.1.1609: complete: Heap-buffer overflow with complete function 9.1.1608: No command-line completion for :unsilent {command} 9.1.1607: :apple command detected as :append 9.1.1606: filetype: a few more files are not recognized 9.1.1605: cannot specify scope for chdir() 9.1.1604: completion: incsearch highlight might be lost 9.1.1603: completion: cannot use autoloaded funcs in 'complete' F{func} 9.1.1602: filetype: requirements-*.txt files are not recognized 9.1.1601: Patch v8.1.0425 was wrong 9.1.1600: using diff anchors with hidden buffers fails silently 9.1.1599: :bnext doesn't go to unlisted help buffers 9.1.1598: filetype: waybar config file is not recognized 9.1.1597: CI reports leaks in libgtk3 library 9.1.1596: tests: Test_search_wildmenu_iminsert() depends on help file 9.1.1595: Wayland: non-portable use of select() 9.1.1594: completion: search completion throws errors 9.1.1593: Confusing error when compiling incomplete try block 9.1.1592: Vim9: crash with classes and garbage collection 9.1.1591: VMS support can be improved 9.1.1590: cannot perform autocompletion 9.1.1589: Cannot disable cscope interface using configure 9.1.1588: Vim9: cannot split dict inside command block 9.1.1587: Wayland: timeout not updated before select() 9.1.1586: Vim9: can define an enum/interface in a function 9.1.1585: Wayland: gvim still needs GVIM_ENABLE_WAYLAND 9.1.1584: using ints as boolean type 9.1.1583: gvim window lost its icons 9.1.1582: style issue in vim9type.c and vim9generics.c 9.1.1581: possible memory leak in vim9generics.c 9.1.1580: possible memory leak in vim9type.c 9.1.1579: Coverity complains about unchecked return value 9.1.1578: configure: comment still mentions autoconf 2.71 9.1.1577: Vim9: no generic support yet 9.1.1576: cannot easily trigger wildcard expansion 9.1.1575: tabpanel not drawn correctly with wrapped lines 9.1.1574: Dead code in mbyte.c 9.1.1573: Memory leak when pressing Ctrl-D in cmdline mode 9.1.1572: expanding $var does not escape whitespace for 'path' 9.1.1571: CmdlineChanged triggered to often 9.1.1570: Copilot suggested some improvements in cmdexpand.c 9.1.1569: tests: Vim9 tests can be improved 9.1.1568: need a few more default highlight groups 9.1.1567: crash when using inline diff mode 9.1.1566: self-referenced enum may not get freed 9.1.1565: configure: does not consider tiny version for wayland 9.1.1564: crash when opening popup to closing buffer 9.1.1563: completion: ruler may disappear 9.1.1562: close button always visible in the 'tabline' 9.1.1561: configure: wayland test can be improved 9.1.1560: configure: uses $PKG_CONFIG before it is defined 9.1.1559: tests: Test_popup_complete_info_01() fails when run alone 9.1.1558: str2blob() treats NULL string and empty string differently 9.1.1557: not possible to anchor specific lines in difff mode 9.1.1556: string handling in cmdexpand.c can be improved 9.1.1555: completion: repeated insertion of leader 9.1.1554: crash when omni-completion opens command-line window 9.1.1553: Vim9: crash when accessing a variable in if condition 9.1.1552: [security]: path traversal issue in tar.vim 9.1.1551: [security]: path traversal issue in zip.vim 9.1.1550: defaults: 'showcmd' is not enabled in non-compatible mode on Unix 9.1.1549: filetype: pkl files are not recognized 9.1.1548: filetype: OpenFGA files are not recognized 9.1.1547: Wayland: missing ifdef 9.1.1546: Vim9: error with has() and short circuit evaluation 9.1.1545: typo in os_unix.c 9.1.1544: :retab cannot be limited to indentation only 9.1.1543: Wayland: clipboard appears to not be working 9.1.1542: Coverity complains about uninitialized variable 9.1.1541: Vim9: error when last enum value ends with a comma 9.1.1540: completion: menu state wrong on interruption 9.1.1539: completion: messages don't respect 'shm' setting 9.1.1537: helptoc: still some issues when markdown code blocks 9.1.1536: tests: test_plugin_comment uses wrong :Check command 9.1.1535: the maximum search count uses hard-coded value 99 9.1.1534: unnecessary code in tabpanel.c 9.1.1533: helptoc: does not handle code sections in markdown well 9.1.1532: termdebug: not enough ways to configure breakpoints 9.1.1531: confusing error with nested legacy function 9.1.1530: Missing version change in v9.1.1529 9.1.1529: Win32: the toolbar in the GUI is old and dated 9.1.1528: completion: crash with getcompletion() 9.1.1527: Vim9: Crash with string compound assignment 9.1.1526: completion: search completion match may differ in case 9.1.1525: tests: testdir/ is a bit messy 9.1.1524: tests: too many imports in the test suite 9.1.1523: tests: test_clipmethod fails in non X11 environment 9.1.1522: tests: still some ANSI escape sequences in test output 9.1.1521: completion: pum does not reset scroll pos on reopen with 'noselect' 9.1.1520: completion: search completion doesn't handle 'smartcase' well 9.1.1519: tests: Test_termdebug_decimal_breakpoints() may fail 9.1.1518: getcompletiontype() may crash 9.1.1517: filetype: autopkgtest files are not recognized 9.1.1516: tests: no test that 'incsearch' is updated after search completion 9.1.1515: Coverity complains about potential unterminated strings 9.1.1514: Coverity complains about the use of tmpfile() 9.1.1513: resizing Vim window causes unexpected internal window width 9.1.1512: completion: can only complete from keyword characters 9.1.1511: tests: two edit tests change v:testing from 1 to 0 9.1.1510: Search completion may use invalid memory 9.1.1509: patch 9.1.1505 was not good 9.1.1508: string manipulation can be improved in cmdexpand.c 9.1.1507: symlinks are resolved on :cd commands 9.1.1506: tests: missing cleanup in Test_search_cmdline_incsearch_highlight() 9.1.1505: not possible to return completion type for :ex command 9.1.1504: filetype: numbat files are not recognized 9.1.1503: filetype: haxe files are not recognized 9.1.1502: filetype: quickbms files are not recognized 9.1.1501: filetype: flix files are not recognized 9.1.1500: if_python: typo in python error variable 9.1.1499: MS-Windows: no indication of ARM64 architecture 9.1.1498: completion: 'complete' funcs behave different to 'omnifunc' 9.1.1497: Link error with shm_open() 9.1.1496: terminal: still not highlighting empty cells correctly 9.1.1495: Wayland: uses $XDG_SEAT to determine seat 9.1.1494: runtime(tutor): no French translation for Chapter 2 9.1.1493: manually comparing positions on buffer 9.1.1492: tests: failure when Wayland compositor fails to start 9.1.1491: missing out-of-memory checks in cmdexpand.c 9.1.1490: 'wildchar' does not work in search contexts 9.1.1489: terminal: no visual highlight of empty cols with empty 'listchars' 9.1.1488: configure: using obsolete macro AC_PROG_GCC_TRADITIONAL 9.1.1487: :cl doesn't invoke :clist 9.1.1486: documentation issues with Wayland 9.1.1485: missing Wayland clipboard support 9.1.1484: tests: Turkish locale tests fails on Mac 9.1.1483: not possible to translation position in buffer 9.1.1482: scrolling with 'splitkeep' and line() 9.1.1481: gcc complains about uninitialized variable 9.1.1480: Turkish translation outdated 9.1.1479: regression when displaying localized percentage position 9.1.1478: Unused assignment in ex_uniq() 9.1.1476: no easy way to deduplicate text 9.1.1476: missing out-of-memory checks in cmdexpand.c 9.1.1475: completion: regression when "nearest" in 'completeopt' 9.1.1474: missing out-of-memory check in mark.c 9.1.1473: inconsistent range arg for :diffget/diffput 9.1.1472: if_python: PySequence_Fast_{GET_SIZE,GET_ITEM} removed 9.1.1471: completion: inconsistent ordering with CTRL-P 9.1.1470: use-after-free with popup callback on error 9.1.1469: potential buffer-underflow with invalid hl_id 9.1.1468: filetype: bright(er)script files are not recognized 9.1.1467: too many strlen() calls 9.1.1466: filetype: not all lex files are recognized 9.1.1465: tabpanel: not correctly drawn with 'equalalways' 9.1.1464: gv does not work in operator-pending mode 9.1.1463: Integer overflow in getmarklist() after linewise operation 9.1.1462: missing change from patch v9.1.1461 9.1.1461: tabpanel: tabpanel vanishes with popup menu 9.1.1460: MS-Windows: too many strlen() calls in os_win32.c 9.1.1459: xxd: coloring output is inefficient 9.1.1458: tabpanel: tabs not properly updated with 'stpl' 9.1.1457: compile warning with tabpanelopt 9.1.1456: comment plugin fails toggling if 'cms' contains \ 9.1.1455: Haiku: dailog objects created with no reference 9.1.1454: tests: no test for pum at line break position 9.1.1453: tests: Test_geometry() may fail 9.1.1452: completion: redundant check for completion flags 9.1.1451: tabpanel rendering artifacts when scrolling 9.1.1450: Session has wrong arglist with :tcd and :arglocal 9.1.1449: typo in pum_display() 9.1.1448: tabpanel is not displayed correctly when msg_scrolled 9.1.1447: completion: crash when backspacing with fuzzy completion 9.1.1446: filetype: cuda-gdb config files are not recognized 9.1.1445: negative matchfuzzy scores although there is a match 9.1.1444: Unused assignment in set_fuzzy_score() 9.1.1443: potential buffer underflow in insertchar() 9.1.1442: tests: Test_diff_fold_redraw() is insufficient 9.1.1441: completion: code can be improved 9.1.1440: too many strlen() calls in os_win32.c 9.1.1439: Last diff folds not merged 9.1.1438: tests: Test_breakindent_list_split() fails 9.1.1437: MS-Windows: internal compile error in uc_list() 9.1.1436: GUI control code is displayed on the console on startup 9.1.1435: completion: various flaws in fuzzy completion 9.1.1434: MS-Windows: missing out-of-memory checks in os_win32.c 9.1.1433: Unnecessary :if when writing session 9.1.1432: GTK GUI: Buffer menu does not handle unicode correctly 9.1.1431: Hit-Enter Prompt when loading session files 9.1.1430: tabpanel may flicker in the GUI 9.1.1429: dragging outside the tabpanel changes tabpagenr 9.1.1428: completion: register completion needs cleanup 9.1.1427: rendering artifacts with the tabpanel 9.1.1426: completion: register contents not completed 9.1.1425: tabpanel: there are still some problems with the tabpanel 9.1.1424: PMenu selection broken with multi-line selection and limits 9.1.1423: :tag command not working correctly using Vim9 Script 9.1.1422: scheduling of complete function can be improved 9.1.1421: tests: need a test for the new-style tutor.tutor 9.1.1420: tests: could need some more tests for shebang lines 9.1.1419: It is difficult to ignore all but some events 9.1.1418: configures GUI auto detection favors GTK2 9.1.1417: missing info about register completion in complete_info() 9.1.1416: completion limits not respected for fuzzy completions 9.1.1415: potential use-after free when there is an error in 'tabpanel' 9.1.1414: MS-Windows: compile warnings in os_win32.c 9.1.1413: spurious CursorHold triggered in GUI on startup 9.1.1412: tests: Test_tabpanel_tabonly() fails on larger screens 9.1.1411: crash when calling non-existing function for tabpanel 9.1.1410: out-of-bounds access with 'completefunc' 9.1.1409: using f-flag in 'complete' conflicts with Neovim 9.1.1408: not easily possible to complete from register content 9.1.1407: Can't use getpos('v') in OptionSet when using setbufvar()- Fix bsc#1228776 / CVE-2024-41965. - Fix bsc#1239602 / CVE-2025-29768. - Refresh patch: vim-7.3-sh_is_bash.patch - Update to 9.1.1406: 9.1.1406: crash when importing invalid tuple 9.1.1405: tests: no test for mapping with special keys in session file 9.1.1404: wrong link to Chapter 2 in new-tutor 9.1.1403: expansion of 'tabpanelopt' value adds wrong values 9.1.1402: multi-byte mappings not properly stored in session file 9.1.1401: list not materialized in prop_list() 9.1.1400: [security]: use-after-free when evaluating tuple fails 9.1.1399: tests: test_codestyle fails for auto-generated files 9.1.1398: completion: trunc does not follow Pmenu highlighting attributes 9.1.1397: tabpanel not correctly updated on :tabonly 9.1.1396: 'errorformat' is a global option 9.1.1395: search_stat not reset when pattern differs in case 9.1.1394: tabpanel not correctly redrawn on tabonly 9.1.1393: missing test for switching buffers and reusing curbuf 9.1.1392: missing patch number 9.1.1391: Vim does not have a vertical tabpanel 9.1.1390: style: more wrong indentation 9.1.1389: completion: still some issue when 'isexpand' contains a space 9.1.1388: Scrolling one line too far with 'nosmoothscroll' page scrolling 9.1.1387: memory leak when buflist_new() fails to reuse curbuf 9.1.1386: MS-Windows: some minor problems building on AARCH64 9.1.1385: inefficient loop for 'nosmoothscroll' scrolling 9.1.1384: still some problem with the new tutors filetype plugin 9.1.1383: completion: 'isexpand' option does not handle space char correct 9.1.1382: if_ruby: unused compiler warnings from ruby internals 9.1.1381: completion: cannot return to original text 9.1.1380: 'eventignorewin' only checked for current buffer 9.1.1379: MS-Windows: error when running evim when space in path 9.1.1378: sign without text overwrites number option 9.1.1377: patch v9.1.1370 causes some GTK warning messages 9.1.1376: quickfix dummy buffer may remain as dummy buffer 9.1.1375: [security]: possible heap UAF with quickfix dummy buffer 9.1.1374: completion: 'smartcase' not respected when filtering matches 9.1.1373: 'completeopt' checking logic can be simplified 9.1.1372: style: braces issues in various files 9.1.1371: style: indentation and brace issues in insexpand.c 9.1.1370: CI Tests favor GTK2 over GTK3 9.1.1369: configure still using autoconf 2.71 9.1.1368: GTK3 and GTK4 will drop numeric cursor support. 9.1.1367: too many strlen() calls in gui.c 9.1.1366: v9.1.1364 unintentionally changed sign.c and sound.c 9.1.1365: MS-Windows: compile warnings and too many strlen() calls 9.1.1364: style: more indentation issues 9.1.1363: style: inconsistent indentation in various files 9.1.1362: Vim9: type ignored when adding tuple to instance list var 9.1.1361: [security]: possible use-after-free when closing a buffer 9.1.1360: filetype: GNU Radio companion files are not recognized 9.1.1359: filetype: GNU Radio config files are not recognized 9.1.1358: if_lua: compile warnings with gcc15 9.1.1357: Vim incorrectly escapes tags with "[" in a help buffer 9.1.1356: Vim9: crash when unletting variable 9.1.1355: The pum_redraw() function is too complex 9.1.1354: tests: Test_terminalwinscroll_topline() fails on Windows 9.1.1353: missing change from v9.1.1350 9.1.1352: style: inconsistent indent in insexpand.c 9.1.1351: Return value of getcmdline() inconsistent in CmdlineLeavePre 9.1.1350: tests: typo in Test_CmdlineLeavePre_cabbr() 9.1.1349: CmdlineLeavePre may trigger twice 9.1.1348: still E315 with the terminal feature 9.1.1347: small problems with gui_w32.c 9.1.1346: missing out-of-memory check in textformat.c 9.1.1345: tests: Test_xxd_color2() test failure dump diff is misleading 9.1.1344: double free in f_complete_match() (after v9.1.1341) 9.1.1343: filetype: IPython files are not recognized 9.1.1342: Shebang filetype detection can be improved 9.1.1341: cannot define completion triggers 9.1.1340: cannot complete :filetype arguments 9.1.1339: missing out-of-memory checks for enc_to_utf16()/utf16_to_enc() 9.1.1338: Calling expand() interferes with cmdcomplete_info() 9.1.1337: Undo corrupted with 'completeopt' "preinsert" when switching buffer 9.1.1336: comment plugin does not support case-insensitive 'commentstring' 9.1.1335: Coverity complains about Null pointer dereferences 9.1.1334: Coverity complains about unchecked return value 9.1.1333: Coverity: complains about unutilized variable 9.1.1332: Vim9: segfault when using super within a lambda 9.1.1331: Leaking memory with cmdcomplete() 9.1.1330: may receive E315 in terminal 9.1.1329: cannot get information about command line completion 9.1.1328: too many strlen() calls in indent.c 9.1.1327: filetype: nroff detection can be improved 9.1.1326: invalid cursor position after 'tagfunc' 9.1.1325: tests: not checking error numbers properly 9.1.1324: undefined behaviour if X11 connection dies 9.1.1323: b:undo_ftplugin not executed when re-using buffer 9.1.1322: small delete register cannot paste multi-line correctly 9.1.1321: filetype: MS ixx and mpp files are not recognized 9.1.1320: filetype: alsoft config files are not recognized 9.1.1319: Various typos in the code, issue with test_inst_complete.vim 9.1.1318: tests: test_format fails 9.1.1317: noisy error when restoring folds from session fails 9.1.1316: missing memory allocation failure in os_mswin.c 9.1.1315: completion: issue with fuzzy completion and 'completefuzzycollect' 9.1.1314: max allowed string width too small 9.1.1313: compile warning about uninitialized value 9.1.1312: tests: Test_backupskip() fails when HOME is defined 9.1.1311: completion: not possible to limit number of matches 9.1.1310: completion: redundant check for preinsert effect 9.1.1309: tests: no test for 'pummaxwidth' with non-truncated "kind" 9.1.1308: completion: cannot order matches by distance to cursor 9.1.1307: make syntax does not reliably detect different flavors 9.1.1306: completion menu rendering can be improved 9.1.1305: completion menu active after switching windows/tabs 9.1.1304: filetype: some man files are not recognized 9.1.1303: missing out-of-memory check in linematch.c 9.1.1302: Coverity warns about using uninitialized value 9.1.1301: completion: cannot configure completion functions with 'complete' 9.1.1300: wrong detection of -inf 9.1.1299: filetype: mbsyncrc files are not recognized 9.1.1298: define_function() is too long 9.1.1297: Ctrl-D scrolling can get stuck 9.1.1296: completion: incorrect truncation logic 9.1.1295: clientserver: does not handle :stopinsert correctly 9.1.1294: gui tabline menu does not use confirm when closing tabs 9.1.1293: comment plugin does not handle 'exclusive' selection for comment object 9.1.1292: statusline not correctly evaluated 9.1.1291: too many strlen() calls in buffer.c 9.1.1290: tests: missing cleanup in test_filetype.vim 9.1.1289: tests: no test for matchparen plugin with WinScrolled event 9.1.1288: Using wrong window in ll_resize_stack() 9.1.1287: quickfix code can be further improved 9.1.1286: filetype: help files not detected when 'iskeyword' includes ":" 9.1.1285: Vim9: no error message for missing method after "super." 9.1.1284: not possible to configure pum truncation char 9.1.1283: quickfix stack is limited to 10 items 9.1.1282: Build and test failure without job feature 9.1.1281: extra newline output when editing stdin 9.1.1280: trailing additional semicolon in get_matches_in_str() 9.1.1279: Vim9: null_object and null_class are no reserved names 9.1.1278: Vim9: too long functions in vim9type.c 9.1.1277: tests: trailing comment char in test_popupwin 9.1.1276: inline word diff treats multibyte chars as word char 9.1.1275: MS-Windows: Not possible to pass additional flags to Make_mvc 9.1.1274: Vim9: no support for object as variable type 9.1.1273: Coverity warns about using uninitialized value 9.1.1272: completion: in keyword completion Ctrl_P cannot go back after Ctrl_N 9.1.1271: filetype: Power Query files are not recognized 9.1.1270: missing out-of-memory checks in buffer.c 9.1.1269: completion: compl_shown_match is updated when starting keyword completion 9.1.1268: filetype: dax files are not recognized 9.1.1267: Vim9: no support for type list/dict> 9.1.1266: MS-Windows: type conversion warnings 9.1.1265: tests: no tests for typing normal char during completion 9.1.1264: Vim9: error when comparing objects 9.1.1263: string length wrong in get_last_inserted_save() 9.1.1262: heap-buffer-overflow with narrow 'pummaxwidth' value 9.1.1261: No test for 'pummaxwidth' non-truncated items 9.1.1260: Hang when filtering buffer with NUL bytes 9.1.1259: some issues with comment package and tailing spaces 9.1.1258: regexp: max \U and \%U value is limited by INT_MAX 9.1.1257: Mixing vim_strsize() with mb_ptr2cells() in pum_redraw() 9.1.1256: if_python: duplicate tuple data entries 9.1.1255: missing test condition for 'pummaxwidth' setting 9.1.1254: need more tests for the comment plugin 9.1.1253: abort when closing window with attached quickfix data 9.1.1252: typos in code and docs related to 'diffopt' "inline:" 9.1.1251: if_python: build error with tuples and dynamic python 9.1.1250: cannot set the maximum popup menu width 9.1.1249: tests: no test that 'listchars' "eol" doesn't affect "gM" 9.1.1248: compile error when building without FEAT_QUICKFIX 9.1.1247: fragile setup to get (preferred) keys from key_name_entry 9.1.1246: coverity complains about some changes in v9.1.1243 9.1.1245: need some more tests for curly braces evaluation 9.1.1244: part of patch v9.1.1242 was wrong 9.1.1243: diff mode is lacking for changes within lines 9.1.1242: Crash when evaluating variable name 9.1.1241: wrong preprocessort indentation in term.c 9.1.1240: Regression with ic/ac text objects and comment plugin 9.1.1239: if_python: no tuple data type support 9.1.1238: wrong cursor column with 'set splitkeep=screen' 9.1.1237: Compile error with C89 compiler in term.c 9.1.1236: tests: test_comments leaves swapfiles around 9.1.1235: cproto files are outdated 9.1.1234: Compile error when SIZE_MAX is not defined 9.1.1233: Coverity warns about NULL pointer when triggering WinResized 9.1.1232: Vim script is missing the tuple data type 9.1.1231: filetype: SPA JSON files are not recognized 9.1.1230: inconsistent CTRL-C behaviour for popup windows 9.1.1229: the comment plugin can be improved 9.1.1228: completion: current position column wrong after got a match 9.1.1227: no tests for the comment package 9.1.1226: "shellcmdline" completion doesn't work with input() 9.1.1225: extra NULL check in VIM_CLEAR() 9.1.1224: cannot :put while keeping indent 9.1.1223: wrong translation used for encoding failures 9.1.1222: using wrong length for last inserted string 9.1.1221: Wrong cursor pos when leaving Insert mode just after 'autoindent' 9.1.1220: filetype: uv.lock file not recognized 9.1.1219: Strange error with wrong type for matchfuzzy() "camelcase" 9.1.1218: missing out-of-memory check in filepath.c 9.1.1217: tests: typos in test_matchfuzzy.vim 9.1.1216: Pasting the '.' register multiple times may not work 9.1.1215: Patch 9.1.1213 has some issues 9.1.1214: matchfuzzy() can be improved for camel case matches 9.1.1213: cannot :put while keeping indent 9.1.1212: too many strlen() calls in edit.c 9.1.1212: filetype: logrotate'd pacmanlogs are not recognized 9.1.1211: TabClosedPre is triggered just before the tab is being freed 9.1.1210: translation(ru): missing Russian translation for the new tutor 9.1.1209: colorcolumn not drawn after virtual text lines 9.1.1208: MS-Windows: not correctly restoring alternate screen on Win 10 9.1.1207: MS-Windows: build warning in filepath.c 9.1.1206: tests: test_filetype fails when a file is a directory 9.1.1205: completion: preinserted text not removed when closing pum 9.1.1204: MS-Windows: crash when passing long string to expand() 9.1.1203: matchparen keeps cursor on case label in sh filetype 9.1.1202: Missing TabClosedPre autocommand 9.1.1201: 'completefuzzycollect' does not handle dictionary correctly 9.1.1200: cmdline pum not cleared for input() completion 9.1.1199: gvim uses hardcoded xpm icon file 9.1.1198: [security]: potential data loss with zip.vim 9.1.1197: process_next_cpt_value() uses wrong condition 9.1.1196: filetype: config files for container tools are not recognized 9.1.1195: inside try-block: fn body executed with default arg undefined 9.1.1194: filetype: false positive help filetype detection 9.1.1193: Unnecessary use of STRCAT() in au_event_disable() 9.1.1192: Vim crashes with term response debug logging enabled 9.1.1191: tests: test for patch 9.1.1186 doesn't fail without the patch 9.1.1190: C indentation does not detect multibyte labels 9.1.1189: if_python: build error due to incompatible pointer types 9.1.1188: runtime(tera): tera support can be improved 9.1.1187: matchparen plugin wrong highlights shell case statement 9.1.1186: filetype: help files in git repos are not detected 9.1.1185: endless loop with completefuzzycollect and no match found 9.1.1184: Unnecessary use of vim_tolower() in vim_strnicmp_asc() 9.1.1083: "above" virtual text breaks cursorlineopt=number 9.1.1182: No cmdline completion for 'completefuzzycollect' 9.1.1181: Unnecessary STRLEN() calls in insexpand.c 9.1.1180: short-description 9.1.1179: too many strlen() calls in misc2.c 9.1.1178: not possible to generate completion candidates using fuzzy matching 9.1.1177: filetype: tera files not detected- Introduce patch to fix bsc#1235751 (regression). * vim-9.1.1134-revert-putty-terminal-colors.patch - Update to 9.1.1176. Changes: * 9.1.1176: wrong indent when expanding multiple lines * 9.1.1175: inconsistent behaviour with exclusive selection and motion commands * 9.1.1174: tests: Test_complete_cmdline() may fail * 9.1.1173: filetype: ABNF files are not detected * 9.1.1172: [security]: overflow with 'nostartofline' and Ex command in tag file * 9.1.1171: tests: wrong arguments passed to assert_equal() * 9.1.1170: wildmenu highlighting in popup can be improved * 9.1.1169: using global variable for get_insert()/get_lambda_name() * 9.1.1168: wrong flags passed down to nextwild() * 9.1.1167: mark '] wrong after copying text object * 9.1.1166: command-line auto-completion hard with wildmenu * 9.1.1165: diff: regression with multi-file diff blocks * 9.1.1164: [security]: code execution with tar.vim and special crafted tar files * 9.1.1163: $MYVIMDIR is set too late * 9.1.1162: completion popup not cleared in cmdline * 9.1.1161: preinsert requires bot "menu" and "menuone" to be set * 9.1.1160: Ctrl-Y does not work well with "preinsert" when completing items * 9.1.1159: $MYVIMDIR may not always be set * 9.1.1158: :verbose set has wrong file name with :compiler! * 9.1.1157: command completion wrong for input() * 9.1.1156: tests: No test for what patch 9.1.1152 fixes * 9.1.1155: Mode message not cleared after :silent message * 9.1.1154: Vim9: not able to use autoload class accross scripts * 9.1.1153: build error on Haiku * 9.1.1152: Patch v9.1.1151 causes problems * 9.1.1151: too many strlen() calls in getchar.c * 9.1.1150: :hi completion may complete to wrong value * 9.1.1149: Unix Makefile does not support Brazilian lang for the installer * 9.1.1148: Vim9: finding imported scripts can be further improved * 9.1.1147: preview-window does not scroll correctly * 9.1.1146: Vim9: wrong context being used when evaluating class member * 9.1.1145: multi-line completion has wrong indentation for last line * 9.1.1144: no way to create raw strings from a blob * 9.1.1143: illegal memory access when putting a register * 9.1.1142: tests: test_startup fails if $HOME/$XDG_CONFIG_HOME is defined * 9.1.1141: Misplaced comment in readfile() * 9.1.1140: filetype: m17ndb files are not detected * 9.1.1139: [fifo] is not displayed when editing a fifo * 9.1.1138: cmdline completion for :hi is too simplistic * 9.1.1137: ins_str() is inefficient by calling STRLEN() * 9.1.1136: Match highlighting marks a buffer region as changed * 9.1.1135: 'suffixesadd' doesn't work with multiple items * 9.1.1134: filetype: Guile init file not recognized * 9.1.1133: filetype: xkb files not recognized everywhere * 9.1.1132: Mark positions wrong after triggering multiline completion * 9.1.1131: potential out-of-memory issue in search.c * 9.1.1130: 'listchars' "precedes" is not drawn on Tabs. * 9.1.1129: missing out-of-memory test in buf_write() * 9.1.1128: patch 9.1.1119 caused a regression with imports * 9.1.1127: preinsert text is not cleaned up correctly * 9.1.1126: patch 9.1.1121 used a wrong way to handle enter * 9.1.1125: cannot loop through pum menu with multiline items * 9.1.1124: No test for 'listchars' "precedes" with double-width char * 9.1.1123: popup hi groups not falling back to defaults * 9.1.1122: too many strlen() calls in findfile.c * 9.1.1121: Enter does not insert newline with "noselect" * 9.1.1120: tests: Test_registers fails * 9.1.1119: Vim9: Not able to use an autoloaded class from another autoloaded script * 9.1.1118: tests: test_termcodes fails * 9.1.1117: there are a few minor style issues * 9.1.1116: Vim9: super not supported in lambda expressions * 9.1.1115: [security]: use-after-free in str_to_reg() * 9.1.1114: enabling termguicolors automatically confuses users * 9.1.1113: tests: Test_terminal_builtin_without_gui waits 2 seconds * 9.1.1112: Inconsistencies in get_next_or_prev_match() * 9.1.1111: Vim9: variable not found in transitive import * 9.1.1110: Vim tests are slow and flaky * 9.1.1109: cmdexpand.c hard to read * 9.1.1108: 'smoothscroll' gets stuck with 'listchars' "eol" * 9.1.1107: cannot loop through completion menu with fuzzy * 9.1.1106: tests: Test_log_nonexistent() causes asan failure * 9.1.1105: Vim9: no support for protected new() method * 9.1.1104: CI: using Ubuntu 22.04 Github runners * 9.1.1103: if_perl: still some compile errors with Perl 5.38 * 9.1.1102: tests: Test_WinScrolled_Resized_eiw() uses wrong filename- 9.1.1101 is a fix for: bsc#1229685 (CVE-2024-43790) bsc#1229822 (CVE-2024-43802) bsc#1230078 (CVE-2024-45306) bsc#1235695 (CVE-2025-22134) bsc#1236151 (CVE-2025-24014) bsc#1237137 (CVE-2025-1215) - Remove obsoleted patch: * vim-7.3-mktemp_tutor.patch - update to 9.1.1101 * insexpand.c hard to read * tests: Test_log_nonexistent only works on Linux * Update base-syntax, improve variable matching * Vim9: import with extends may crash * leaking memory with completing multi lines * --log with non-existent path causes a crash * if_perl: Perl 5.38 adds new symbols causing link failure * tests: matchparen plugin test wrongly named * Vim9: problem finding implemented method in type hierarchy * runtime(qf): Update syntax file, match second delimiter * tests: output of test ...win32_ctrl_z depends on python version * tests: fix expected return code for python 3.13 on Windows * tests: timeout might be a bit too small * tests: test_terminwscroll_topline2 unreliable * tests: No check when tests are run under Github actions * tests: plugin tests are named inconsistently * Vim9: import with extends may crash * completion doesn't work with multi lines * filetype: cmmt files are not recognized * Unable to persistently ignore events in a window and its buffers * improve syntax highlighting * setreg() doesn't correctly handle mbyte chars in blockwise mode * unexpected DCS responses may cause out of bounds reads * has('bsd') is true for GNU/Hurd * filetype: Mill files are not recognized * GUI late startup leads to uninitialized scrollbars * Add support for lz4 to tar & gzip plugin * Terminal ansi colors off by one after tgc reset * included syntax items do not understand contains=TOP * vim_strnchr() is strange and unnecessary * Vim9: len variable not used in compile_load() * runtime(vim): Update base-syntax, match :debuggreedy count prefix * Strange error when heredoc marker starts with "trim" * tests: test_compiler fails on Windows without Maven * 'diffopt' "linematch" cannot be used with {n} less than 10 * args missing after failing to redefine a function * Cannot control cursor positioning of getchar() * preinsert text completions not deleted with / * getchar() can't distinguish between C-I and Tab * tests: Test_termwinscroll_topline2 fails on MacOS * heap-use-after-free and stack-use-after-scope with :14verbose * no digraph for "Approaches the limit" * not possible to use plural forms with gettext() * too many strlen() calls in userfunc.c * terminal: E315 when dragging the terminal with the mouse * runtime(openPlugin): fix unclosed parenthesis in GetWordUnderCursor() * runtime(doc): Tweak documentation style a bit * tests: test_glvs fails when unarchiver not available * Vim always enables 'termguicolors' in a terminal * completion: input text deleted with preinsert when adding leader * translation(sr): Missing Serbian translation for the tutor * Superfluous cleanup steps in test_ins_complete.vim * runtime(netrw): correct wrong version check * Vim doesn't highlight to be inserted text when completing * runtime(netrw): upstream snapshot of v176 * runtime(dist/vim9): fix regressions in dist#vim9#Open * runtime(hyprlang): fix string recognition * make install fails because of a missing dependency * runtime(asm): add byte directives to syntax script * Vim doesn't work well with TERM=xterm-direct * runtime(filetype): commit 99181205c5f8284a3 breaks V lang detection * runtime: decouple Open and Launch commands and gx mapping from netrw * "nosort" enables fuzzy filtering even if "fuzzy" isn't in 'completeopt' * runtime(just): fix typo in syntax file * runtime(filetype): Improve Verilog detection by checking for modules definition * tests: off-by-one error in CheckCWD in test_debugger.vim * tests: no support for env variables when running Vim in terminal * too many strlen() calls in os_unix.c * insert-completed items are always sorted * crash after scrolling and pasting in silent Ex mode * Makefiles uses non-portable syntax * fuzzymatching doesn't prefer matching camelcase * filetype: N-Tripels and TriG files are not recognized * Vim9: Patch 9.1.1014 causes regressions * translation(sr): Update Serbian messages translation - updade to 9.1.1043 * [security]: segfault in win_line() * update helptags * filetype: just files are not recognized * Update base-syntax, match ternary and falsy operators * Vim9: out-of-bound access when echoing an enum * Vim9: imported type cannot be used as func return type * runtime(kconfig): updated ftplugin and syntax script * runtime(doc): rename last t_BG reference to t_RB * Vim9: comments are outdated * tests: test_channel.py fails with IPv6 * runtime(vim): Update base-syntax, fix is/isnot operator matching * Vim9: confusing error when using abstract method via super * make install fails when using shadowdir * Vim9: memory leak with blob2str() * runtime(tex): add texEmphStyle to texMatchGroup in syntax script * runtime(netrw): upstream snapshot of v175 * Vim9: compiling abstract method fails without return * runtime(c): add new constexpr keyword to syntax file (C23) * tests: shaderslang was removed from test_filetype erroneously * link error when FEAT_SPELL not defined * Coverity complains about insecure data handling * runtime(sh): update syntax script * runtime(c): Add missing syntax test files * filetype: setting bash filetype is backwards incompatible * runtime(c): Update syntax and ftplugin files * the installer can be improved * too many strlen() calls in screen.c * no sanitize check when running linematch * filetype: swc configuration files are not recognized * runtime(netrw): change netrw maintainer * wrong return type of blob2str() * blob2str/str2blob() do not support list of strings * runtime(doc): fix typo in usr_02.txt * Coverity complains about dereferencing NULL pointer * linematch option value not completed * string might be used without a trailing NUL * no way to get current selected item in a async context * filetype: fd ignore files are not recognized * v9.1.0743 causes regression with diff mode * runtime(doc): fix base64 encode/decode examples * Vim9: Patch 9.1.1013 causes a few problems * Not possible to convert string2blob and blob2string * Coverity complains about dereferencing NULL value * Vim9: variable not found in transitive import * runtime(colors): Update colorschemes, include new unokai colorscheme * Vim9: Regression caused by patch v9.1.0646 * runtime(lyrics): support milliseconds in syntax script * runtime(vim): Split Vim legacy and Vim9 script indent tests * Vim9: class interface inheritance not correctly working * popupmenu internal error with some abbr in completion item * filetype: VisualCode setting file not recognized * diff feature can be improved * tests: test for patch 9.1.1006 doesn't fail without the patch * filetype: various ignore are not recognized * tests: Load screendump files with "git vimdumps" * PmenuMatch completion highlight can be combined * completion text is highlighted even with no pattern found * tests: a few termdebug tests are flaky * [security]: heap-buffer-overflow with visual mode * runtime(doc): add package- helptags for included packages * Vim9: unknown func error with interface declaring func var * runtime(filetype): don't detect string interpolation as angular * ComplMatchIns highlight hard to read on light background * runtime(vim): Update base-syntax, highlight literal string quote escape * runtime(editorconfig): set omnifunc to syntaxcomplete func * tests: ruby tests fail with Ruby 3.4 * Vim9: leaking finished exception * runtime(tiasm): use correct syntax name tiasm in syntax script * filetype: TI assembly files are not recognized * too many strlen() calls in drawscreen.c * runtime(xf86conf): add section name OutputClass to syntax script * ComplMatchIns may highlight wrong text * runtime(vim): Update base-syntax, improve ex-bang matching * runtime(doc): clarify buffer deletion on popup_close() * filetype: shaderslang files are not detected * Vim9: not able to use comment after opening curly brace - update to 9.1.0993 * 9.1.0993: New 'cmdheight' behavior may be surprising * runtime(sh): fix typo in Last Change header * 9.1.0992: Vim9: double-free after v9.1.0988 * 9.1.0991: v:stacktrace has wrong type in Vim9 script * runtime(sh): add PS0 to bashSpecialVariables in syntax script * runtime(vim): Remove trailing comma from match_words * runtime(zsh): sync syntax script with upstream repo * runtime(doc): Capitalise the mnemonic "Zero" for the 'z' flag of search() * 9.1.0990: Inconsistent behavior when changing cmdheight * 9.1.0989: Vim9: Whitespace after the final enum value causes a syntax error * runtime(java): Quietly opt out for unsupported markdown.vim versions * runtime(vim): fix failing vim syntax test * 9.1.0988: Vim9: no error when using uninitialized var in new() * runtime(doc): update index.txt * 9.1.0987: filetype: cake files are not recognized * 9.1.0986: filetype: 'jj' filetype is a bit imprecise * runtime(jj): Support diffs in jj syntax * runtime(vim): Update matchit pattern, no Vim9 short names * 9.1.0985: Vim9: some ex commands can be shortened * 9.1.0984: exception handling can be improved * runtime(doc): update doc for :horizontal * runtime(doc): update index.txt, windows.txt and version9.txt * runtime(doc): Tweak documentation about base64 function * runtime(chordpro): update syntax script * 9.1.0983: not able to get the displayed items in complete_info() * runtime(doc): use standard SGR format at :h xterm-true-color * 9.1.0982: TI linker files are not recognized * runtime(vim): update vim generator syntax script * 9.1.0981: tests: typo in test_filetype.vim * 9.1.0980: no support for base64 en-/decoding functions in Vim Script * syntax(sh): Improve the recognition of bracket expressions * runtime(doc): mention how NUL bytes are handled * 9.1.0979: VMS: type warning with $XDG_VIMRC_FILE * 9.1.0978: GUI tests sometimes fail when setting 'scroll' options * 9.1.0977: filetype: msbuild filetypes are not recognized * 9.1.0976: Vim9: missing return statement with throw * 9.1.0975: Vim9: interpolated string expr not working in object methods * 9.1.0974: typo in change of commit v9.1.0873 * 9.1.0973: too many strlen() calls in fileio.c * runtime(sh): set shellcheck as the compiler for supported shells * runtime(doc): Fix enum example syntax * 9.1.0972: filetype: TI linker map files are not recognized * runtime(vim): Improve syntax script generator for Vim Script * 9.1.0971: filetype: SLNX files are not recognized * 9.1.0970: VMS: build errors on VMS architecture * runtime(doc): Fix documentation typos * runtime(doc): update for new keyprotocol option value (after v9.1.0969) * 9.1.0969: ghostty not using kitty protocol by default * 9.1.0968: tests: GetFileNameChecks() isn't fully sorted by filetype name * runtime(doc): update version9.txt for bash filetype * runtime(netrw): update last change header for #16265 * runtime(doc): fix doc error in :r behaviour * 9.1.0967: SpotBugs compiler setup can be further improved * 9.1.0966: Vim9: :enum command can be shortened * runtime(compiler): include a basic bash syntax checker compiler * 9.1.0965: filetype: sh filetype set when detecting the use of bash * runtime(doc): clarify ARCH value for 32-bit in INSTALLpc.txt * 9.1.0963: fuzzy-matching does not prefer full match * 9.1.0962: filetype: bun.lock file is not recognized * runtime(vim): update indentation plugin for Vim script * runtime(doc): tweak documentation style in helphelp.txt * runtime(vim): Update base-syntax, allow parens in default arguments * runtime(doc): mention auto-format using clang-format for sound.c/sign.c * runtime(help): fix typo s/additional/arbitrary/ * runtime(help): Add better support for language annotation highlighting * 9.1.0961: filetype: TI gel files are not recognized * 9.1.0960: filetype: hy history files are not recognized * translation(fi): Fix typoes in Finish menu translation * 9.1.0959: Coverity complains about type conversion * runtime(vim): Use supported syntax in indent tests * 9.1.0958: filetype: supertux2 config files detected as lisp * 9.1.0956: completion may crash, completion highlight wrong with preview window * 9.1.0955: Vim9: vim9compile.c can be further improved * runtime(doc): move help tag E1182 * runtime(graphql): contribute vim-graphql to Vim core * 9.1.0954: popupmenu.c can be improved * 9.1.0953: filetype: APKBUILD files not correctly detected * 9.1.0952: Vim9: missing type checking for any type assignment * 9.1.0951: filetype: jshell files are not recognized * runtime(dockerfile): do not set commentstring in syntax script * 9.1.0950: filetype: fennelrc files are not recognized * runtime(netrw): do not double escape Vim special characters * git: ignore reformatting change of netrw plugin * runtime(netrw): more reformating #16248 * runtime(doc): Add a note about handling symbolic links in starting.txt * 9.1.0949: popups inconsistently shifted to the left * git: ignore reformatting change of netrw plugin * runtime(netrw): change indent size from 1 to 2 * 9.1.0948: Missing cmdline completion for :pbuffer * runtime(tutor): Reformat tutor1 * 9.1.0947: short-description * 9.1.0946: cross-compiling fails on osx-arm64 * 9.1.0945: ComplMatchIns highlight doesn't end after inserted text * translation(sv): re-include the change from #16240 * 9.1.0944: tests: test_registers fails when not run under X11 * 9.1.0943: Vim9: vim9compile.c can be further improved * runtime(doc): Update README and mention make check to verify * translation(sv): partly revert commit 98874dca6d0b60ccd6fc3a140b3ec * runtime(vim): update base-syntax after v9.1.0936 * 9.1.0942: a few typos were found * 9.1.0941: ComplMatchIns doesn't work after multibyte chars * runtime(doc): Fix style in fold.txt * translation(sv): Fix typo in Swedish translation * 9.1.0940: Wrong cursor shape with "gq" and 'indentexpr' executes :normal * runtime(doc): fix some small errors * 9.1.0939: make installtutor fails * 9.1.0938: exclusive selection not respected when re-selecting block mode * 9.1.0937: test_undolist() is flaky * 9.1.0936: cannot highlight completed text * 9.1.0935: SpotBugs compiler can be improved * 9.1.0934: hard to view an existing buffer in the preview window * runtime(doc): document how to minimize fold computation costs * 9.1.0933: Vim9: vim9compile.c can be further improved * 9.1.0932: new Italian tutor not installed * runtime(doc): fix a few minor errors from the last doc updates * translation(it): add Italian translation for the interactive tutor * runtime(doc): update the change.txt help file * runtime(help): Add Vim lang annotation support for codeblocks * 9.1.0931: ml_get error in terminal buffer * 9.1.0930: tests: test_terminal2 may hang in GUI mode * 9.1.0929: filetype: lalrpop files are not recognized * 9.1.0928: tests: test_popupwin fails because the filter command fails * editorconfig: set trim_trailing_whitespace = false for src/testdir/test*.vim * 9.1.0927: style issues in insexpand.c * 9.1.0926: filetype: Pixi lock files are not recognized * runtime(doc): Add a reference to |++opt| and |+cmd| at `:h :pedit` * runtime(doc): add a note about inclusive motions and exclusive selection * 9.1.0925: Vim9: expression compiled when not necessary * 9.1.0924: patch 9.1.0923 causes issues * 9.1.0923: too many strlen() calls in filepath.c * 9.1.0923: wrong MIN macro in popupmenu.c * 9.1.0921: popupmenu logic is a bit convoluted * 9.1.0920: Vim9: compile_assignment() too long * 9.1.0919: filetype: some assembler files are not recognized * runtime(netrw): do not pollute search history with symlinks * 9.1.0918: tiny Vim crashes with fuzzy buffer completion * 9.1.0917: various vartabstop and shiftround bugs when shifting lines * runtime(typst): add definition lists to formatlistpat, update maintainer * 9.1.0916: messages.c is exceeding 80 columns * runtime(proto): include filetype plugin for protobuf * 9.1.0915: GVim: default font size a bit too small * 9.1.0914: Vim9: compile_assignment() is too long * 9.1.0913: no error check for neg values for 'messagesopt' * runtime(netrw): only check first arg of netrw_browsex_viewer for being executable * 9.1.0912: xxd: integer overflow with sparse files and -autoskip * 9.1.0911: Variable name for 'messagesopt' doesn't match short name * 9.1.0910: 'messagesopt' does not check max wait time * runtime(doc): update wrong Vietnamese localization tag * 9.1.0909: Vim9: crash when calling instance method - update to 9.1.0908 * refresh vim-7.3-mktemp_tutor.patch * 9.1.0908: not possible to configure :messages * 9.1.0907: printoptions:portrait does not change postscript Orientation * runtime(doc): Add vietnamese.txt to helps main TOC * 9.1.0906: filetype: Nvidia PTX files are not recognized * runtime(doc): updated version9.txt with changes from v9.1.0905 * 9.1.0905: Missing information in CompleteDone event * 9.1.0904: Vim9: copy-paste error in class_defining_member() * 9.1.0903: potential overflow in spell_soundfold_wsal() * runtime(netrw): do not detach when launching external programs in gvim * runtime(doc): make tag alignment more consistent in filetype.txt * runtime(doc): fix wrong syntax and style of vietnamese.txt * translation(it): update Italian manpage for vimtutor * runtime(lua): add optional lua function folding * Filelist: include translations for Chapter 2 tutor * translation(vi): Update Vietnamese translation * runtime(doc): include vietnamese.txt * runtime(tutor): fix another typo in tutor2 * runtime(doc): fix typo in vimtutor manpage * translation(it): update Italian manpage for vimtutor * translation(it): include Italian version of tutor chapter 2 * runtime(tutor): regenerated some translated tutor1 files * runtime(tutor): fix typo in Chapter 2 * 9.1.0902: filetype: Conda configuration files are not recognized * runtime(doc): Tweak documentation style a bit * runtime(tutor): update the tutor files and re-number the chapters * runtime(tutor): Update the makefiles for tutor1 and tutor2 files * 9.1.0901: MS-Windows: vimtutor batch script can be improved * runtime(doc): remove buffer-local completeopt todo item * 9.1.0900: Vim9: digraph_getlist() does not accept bool arg * runtime(typst): provide a formatlistpat in ftplugin * runtime(doc): Update documentation for "noselect" in 'completeopt' * 9.1.0899: default for 'backspace' can be set in C code * runtime(helptoc): reload cached g:helptoc.shell_prompt when starting toc * translation(ru): Updated messages translation * 9.1.0898: runtime(compiler): pytest compiler not included * 9.1.0897: filetype: pyrex files are not detected * runtime(compiler): update eslint compiler * 9.1.0896: completion list wrong after v9.1.0891 * runtime(doc): document changed default value for 'history' * 9.1.0895: default history value is too small * 9.1.0894: No test for what the spotbug compiler parses * 9.1.0893: No test that undofile format does not regress * translation(de): update German manpages * runtime(compiler): include spotbugs Java linter * 9.1.0892: the max value of 'tabheight' is limited by other tabpages * runtime(po): remove poDiffOld/New, add po-format flags to syntax file * 9.1.0891: building the completion list array is inefficient * patch 9.1.0890: %! item not allowed for 'rulerformat' * runtime(gzip): load undofile if there exists one * 9.1.0889: Possible unnecessary redraw after adding/deleting lines * 9.1.0888: leftcol property not available in getwininfo() * 9.1.0887: Wrong expression in sign.c * 9.1.0886: filetype: debian control file not detected * runtime(c3): include c3 filetype plugin * 9.1.0885: style of sign.c can be improved * 9.1.0884: gcc warns about uninitialized variable * runtime(apache): Update syntax directives for apache server 2.4.62 * translation(ru): updated vimtutor translation, update MAINTAINERS file * 9.1.0883: message history cleanup is missing some tests * runtime(doc): Expand docs on :! vs. :term * runtime(netrw): Fixing powershell execution issues on Windows * 9.1.0882: too many strlen() calls in insexpand.c * 9.1.0881: GUI: message dialog may not get focus * runtime(netrw): update netrw's decompress logic * runtime(apache): Update syntax keyword definition * runtime(misc): add Italian LICENSE and (top-level) README file * 9.1.0880: filetype: C3 files are not recognized * runtime(doc): add helptag for :HelpToc command * 9.1.0879: source is not consistently formatted * Add clang-format config file * runtime(compiler): fix escaping of arguments passed to :CompilerSet * 9.1.0878: termdebug: cannot enable DEBUG mode * 9.1.0877: tests: missing test for termdebug + decimal signs * 9.1.0876: filetype: openCL files are not recognized * 9.1.0875: filetype: hyprlang detection can be improved * 9.1.0874: filetype: karel files are not detected * 9.1.0873: filetype: Vivado files are not recognized * 9.1.0872: No test for W23 message * 9.1.0871: getcellpixels() can be further improved * 9.1.0870: too many strlen() calls in eval.c * 9.1.0869: Problem: curswant not set on gm in folded line * 9.1.0868: the warning about missing clipboard can be improved * runtime(doc): Makefile does not clean up all temporary files * 9.1.0867: ins_compl_add() has too many args * editorconfig: don't trim trailing whitespaces in runtime/doc * translation(am): Remove duplicate keys in desktop files * runtime(doc): update helptags * runtime(filetype): remove duplicated *.org file pattern * runtime(cfg): only consider leading // as starting a comment * 9.1.0866: filetype: LLVM IR files are not recognized * 9.1.0865: filetype: org files are not recognized * 9.1.0864: message history is fixed to 200 * 9.1.0863: getcellpixels() can be further improved * runtime(sh): better function support for bash/zsh in indent script * runtime(netrw): small fixes to netrw#BrowseX * 9.1.0862: 'wildmenu' not enabled by default in nocp mode * runtime(doc): update how to report issues for mac Vim * runtime(doc): mention option-backslash at :h CompilerSet * runtime(compiler): include a Java Maven compiler plugin * runtime(racket): update Racket runtime files * runtime(doc): improve indentation in examples for netrw-handler * runtime(doc): improve examples for netrw-handler functions * runtime(idris2): include filetype,indent+syntax plugins for (L)Idris2 + ipkg * runtime(doc): clarify the use of filters and external commands * 9.1.0861: Vim9: no runtime check for object member access of any var * runtime(compiler): update pylint linter * 9.1.0860: tests: mouse_shape tests use hard code sleep value * 9.1.0859: several problems with the GLVS plugin * 9.1.0858: Coverity complains about dead code * runtime(tar): Update tar.vim to support permissions * 9.1.0857: xxd: --- is incorrectly recognized as end-of-options * 9.1.0851: too many strlen() calls in getchar.c * 9.1.0850: Vim9: cannot access nested object inside objects * runtime(tex): extra Number highlighting causes issues * runtime(vim): Fix indent after :silent! function * 9.1.0849: there are a few typos in the source * runtime(netrw): directory symlink not resolved in tree view * runtime(doc): add a table of supported Operating Systems * runtime(tex): update Last Change header in syntax script * runtime(doc): fix typo in g:termdebug_config * runtime(vim): Update base-syntax, improve :normal highlighting * runtime(tex): add Number highlighting to syntax file * runtime(doc): Tweak documentation style a bit * 9.1.0848: if_lua: v:false/v:true are not evaluated to boolean * runtime(dune): use :setl instead of :set in ftplugin * runtime(termdebug): allow to use decimal signs * translation(it): Updated Italian vimtutor * runtime(compiler): improve cppcheck * git: git-blame-ignore-revs shown as an error on Github * 9.1.0847: tests: test_popupwin fails because of updated help file * 9.1.0846: debug symbols for xxd are not cleaned in Makefile * runtime(structurizr): Update structurizr syntax * runtime(8th): updated 8th syntax * runtime(doc): Add pi_tutor.txt to help TOC * runtime(compiler): add mypy and ruff compiler; update pylint linter * runtime(netrw): fix several bugs in netrw tree listing * runtime(netrw): prevent polluting the search history * 9.1.0845: vimtutor shell script can be improved * 9.1.0844: if_python: no way to pass local vars to python * 9.1.0843: too many strlen() calls in undo.c * runtime(doc): update default value for fillchars option * runtime(compiler): fix typo in cppcheck compiler plugin * runtime(doc): simplify vimtutor manpage a bit more * runtime(matchparen): Add matchparen_disable_cursor_hl config option * 9.1.0842: not checking for the sync() systemcall * 9.1.0841: tests: still preferring python2 over python3 * 9.1.0840: filetype: idris2 files are not recognized * 9.1.0839: filetype: leo files are not recognized * runtime(cook): include cook filetype plugin * runtime(debversions): Update Debian versions * patch 9.1.0838: vimtutor is bash-specific * runtime(doc): add help specific modeline to pi_tutor.txt * Filelist: vimtutor chapter 2 is missing in Filelist * 9.1.0837: cross-compiling has some issues * runtime(vimtutor): Add a second chapter- Fix for bsc#1234333 / bsc#1234214 / bsc#1234245. These three bugs all have the same root cause: Package 'xxd' has been obsoleted by Vim, as it provides the xxd files directly. However, because the "Obsoletes" entry was versioned, depending on which version of 'xxd' that is installed, the "Obsoletes" isn't actually triggered. Thus, there is a conflict between "vim" and "xxd" in these cases. Fixing this by removing the version completely. The 'vim' package should always replace 'xxd', even if people are migrating from an older SLE15 service pack which has the exact same version.- Fix for bsc#1231373 / CVE-2024-47814. - Fix for bsc#1229238 / CVE-2024-43374. - update to 9.1.0836 * 9.1.0836: The vimtutor can be improved * 9.1.0835: :setglobal doesn't work properly for 'ffu' and 'tsrfu' * 9.1.0834: tests: 2html test fails * 9.1.0833: CI: recent ASAN changes do not work for indent tests * 9.1.0832: :set doesn't work for 'cot' and 'bkc' after :setlocal * runtime(doc): update help-toc description * runtime(2html): Make links use color scheme colors in TOhtml * 9.1.0831: 'findexpr' can't be used as lambad or Funcref * Filelist: include helptoc package * runtime(doc): include a TOC Vim9 plugin * Filelist: ignore .git-blame-ignore-revs * 9.1.0830: using wrong highlight group for spaces for popupmenu * runtime(typst): synchronize updates from the upstream typst.vim * git: ignore reformatting commit for git-blame (after v9.1.0829) * 9.1.0829: Vim source code uses a mix of tabs and spaces * 9.1.0828: string_T struct could be used more often * 9.1.0827: CI: tests can be improved * runtime(doc): remove stray sentence in pi_netrw.txt * 9.1.0826: filetype: sway files are not recognized * runtime(doc): Include netrw-gp in TOC * runtime(doc): mention 'iskeyword' at :h charclass() * runtime(doc): update help tags * 9.1.0825: compile error for non-diff builds * runtime(netrw): fix E874 when browsing remote directory which contains `~` character * runtime(doc): update coding style documentation * runtime(debversions): Add plucky (25.04) as Ubuntu release name * 9.1.0824: too many strlen() calls in register.c * 9.1.0823: filetype: Zephyr overlay files not recognized * runtime(doc): Clean up minor formatting issues for builtin functions * runtime(netrw): make :Launch/Open autoloadable * runtime(netrw): fix regression with x mapping on Cygwin * runtime(netrw): fix filetype detection for remote files * 9.1.0822: topline might be changed in diff mode unexpectedly * CI: huge linux builds should also run syntax & indent tests * 9.1.0821: 'findexpr' completion doesn't set v:fname to cmdline argument * 9.1.0820: tests: Mac OS tests are too flaky * runtime(awk): Highlight more awk comments in syntax script * runtime(netrw): add missing change for s:redir() * 9.1.0819: tests: using findexpr and imported func not tested * runtime(netrw): improve netrw's open-handling further * runtime(netrw): fix syntax error in netrwPlugin.vim * runtime(netrw): simplify gx file handling * 9.1.0818: some global functions are only used in single files * 9.1.0817: termdebug: cannot evaluate expr in a popup * runtime(defaults): Detect putty terminal and switch to dark background * 9.1.0816: tests: not clear what tests cause asan failures * runtime(doc): Remove some completed items from todo.txt * 9.1.0815: "above" virtual text causes wrong 'colorcolumn' position * runtime(syntax-tests): tiny vim fails because of line-continuation * 9.1.0814: mapset() may remove unrelated mapping * 9.1.0813: no error handling with setglobal and number types * 9.1.0812: Coverity warns about dereferencing NULL ptr * 9.1.0811: :find expansion does not consider 'findexpr' * 9.1.0810: cannot easily adjust the |:find| command * 9.1.0809: filetype: petalinux config files not recognized * 9.1.0808: Terminal scrollback doesn't shrink when decreasing 'termwinscroll' * 9.1.0807: tests: having 'nolist' in modelines isn't always desired * 9.1.0806: tests: no error check when setting global 'briopt' * 9.1.0805: tests: minor issues in gen_opt_test.vim * 9.1.0804: tests: no error check when setting global 'cc' * 9.1.0803: tests: no error check when setting global 'isk' * 9.1.0802: tests: no error check when setting global 'fdm' to empty value * 9.1.0801: tests: no error check when setting global 'termwinkey' * 9.1.0800: tests: no error check when setting global 'termwinsize' * runtime(doc): :ownsyntax also resets 'spelloptions' * 9.1.0799: tests: gettwinvar()/gettabwinvar() tests are not comprehensive * runtime(doc): Fix wrong Mac default options * 9.1.0798: too many strlen() calls in cmdhist.c * 9.1.0797: testing of options can be further improved * 9.1.0796: filetype: libtool files are not recognized * (typst): add folding to typst ftplugin * runtime(netrw): deprecate and remove netrwFileHandlers#Invoke() * 9.1.0795: filetype: Vivado memory info file are not recognized * 9.1.0794: tests: tests may fail on Windows environment * runtime(doc): improve the :colorscheme documentation * 9.1.0793: xxd: -e does add one extra space * 9.1.0792: tests: Test_set_values() is not comprehensive enough * runtime(swayconfig): add flag for bindsym/bindcode to syntax script * 9.1.0791: tests: errors in gen_opt_test.vim are not shown * runtime(compiler): check for compile_commands in build dirs for cppcheck * 9.1.0790: Amiga: AmigaOS4 build should use default runtime (newlib) * runtime(help): Update help syntax * runtime(help): fix end of sentence highlight in code examples * runtime(jinja): Support jinja syntax as secondary filetype * 9.1.0789: tests: ':resize + 5' has invalid space after '+' * 9.1.0788: 27;u is not decoded to literal Escape in kitty/foot * 9.1.0787: cursor position changed when using hidden terminal * 9.1.0786: tests: quickfix update test does not test location list * runtime(doc): add some docs for file-watcher programs * CI: uploading failed screendumps still fails on Cirrus CI * 9.1.0785: cannot preserve error position when setting quickfix list * 9.1.0784: there are several problems with python 3.13 * 9.1.0783: 'spell' option setting has problems * 9.1.0782: tests: using wrong neomuttlog file name * runtime(doc): add preview flag to statusline example * 9.1.0781: tests: test_filetype fails * 9.1.0780: MS-Windows: incorrect Win32 error checking * 9.1.0779: filetype: neomuttlog files are not recognized * 9.1.0778: filetype: lf config files are not recognized * runtime(comment): fix commment toggle with mixed tabs & spaces * runtime(misc): Use consistent "Vim script" spelling * runtime(gleam): add ftplugin for gleam files * runtime(doc): link help-writing from write-local-help * 9.1.0777: filetype: Some upstream php files are not recognized * runtime(java): Define javaBlockStart and javaBlockOtherStart hl groups * runtime(doc): mention conversion rules for remote_expr() * runtime(tutor): Fix missing :s command in spanish translation section 4.4 * 9.1.0776: test_strftime may fail because of missing TZ data * translation(am): Add Armenian language translation * 9.1.0775: tests: not enough tests for setting options * 9.1.0774: "shellcmdline" doesn't work with getcompletion() * 9.1.0773: filetype: some Apache files are not recognized * 9.1.0772: some missing changes from v9.1.0771 * 9.1.0771: completion attribute hl_group is confusing * 9.1.0770: current command line completion is a bit limited * 9.1.0769: filetype: MLIR files are not recognized * 9.1.0768: MS-Windows: incorrect cursor position when restoring screen * runtime(nasm): Update nasm syntax script * 9.1.0767: A condition is always true in ex_getln.c * runtime(skill): Update syntax file to fix string escapes * runtime(help): highlight CTRL- correctly * runtime(doc): add missing usr_52 entry to toc * 9.1.0766: too many strlen() calls in ex_getln.c * runtime(doc): correct `vi` registers 1-9 documentation error * 9.1.0765: No test for patches 6.2.418 and 7.3.489 * runtime(spec): set comments and commentstring options * NSIS: Include libgcc_s_sjlj-1.dll again * runtime(doc): clarify the effect of 'startofline' option * 9.1.0764: [security]: use-after-free when closing a buffer * runtime(vim): Update base-syntax file, improve class, enum and interface highlighting * 9.1.0763: tests: cannot run single syntax tests * 9.1.0762: 'cedit', 'termwinkey' and 'wildchar' may not be parsed correctly * 9.1.0761: :cd completion fails on Windows with backslash in path * 9.1.0760: tests: no error reported, if gen_opt_test.vim fails * 9.1.0759: screenpos() may return invalid position * runtime(misc): unset compiler in various ftplugins * runtime(doc): update formatting and syntax * runtime(compiler): add cppcheck linter compiler plugin * runtime(doc): Fix style in documents * runtime(doc): Fix to two-space convention in user manual * runtime(comment): consider &tabstop in lines after whitespace indent * 9.1.0758: it's possible to set an invalid key to 'wildcharm' * runtime(java): Manage circularity for every :syn-included syntax file * 9.1.0757: tests: messages files contains ANSI escape sequences * 9.1.0756: missing change from patch v9.1.0754 * 9.1.0755: quickfix list does not handle hardlinks well * runtime(doc): 'filetype', 'syntax' and 'keymap' only allow alphanumeric + some characters * runtime(systemd): small fixes to &keywordprg in ftplugin * CI: macos-12 runner is being sunset, switch to 13 * 9.1.0754: fixed order of items in insert-mode completion menu * runtime(comment): commenting might be off by one column * 9.1.0753: Wrong display when typing in diff mode with 'smoothscroll' * 9.1.0752: can set 'cedit' to an invalid value * runtime(doc): add `usr` tag to usr_toc.txt * 9.1.0751: Error callback for term_start() not used * 9.1.0750: there are some Win9x legacy references * runtime(java): Recognise the CommonMark form (///) of Javadoc comments * 9.1.0749: filetype: http files not recognized * runtime(comment): fix syntax error * CI: uploading failed screendump tests does not work Cirrus * 9.1.0748: :keep* commmands are sometimes misidentified as :k * runtime(indent): allow matching negative numbers for gnu indent config file * runtime(comment): add gC mapping to (un)comment rest of line * 9.1.0747: various typos in repo found * 9.1.0746: tests: Test_halfpage_longline() fails on large terminals * runtime(doc): reformat gnat example * runtime(doc): reformat ada_standard_types section * 9.1.0745: filetype: bun and deno history files not recognized * runtime(glvs): Correct the tag name of glvs-autoinstal * runtime(doc): include short form for :earlier/:later * runtime(doc): remove completed TODO * 9.1.0744: filetype: notmuch configs are not recognised * 9.1.0743: diff mode does not handle overlapping diffs correctly * runtime(glvs): fix a few issues * runtime(doc): Fix typo in :help :command-modifiers * 9.1.0742: getcmdprompt() implementation can be improved * runtime(docs): update `:set?` command behavior table * runtime(doc): update vim90 to vim91 in docs * runtime(doc): fix typo in :h dos-colors * 9.1.0741: No way to get prompt for input()/confirm() * runtime(doc): fix typo in version9.txt nrformat -> nrformats * runtime(rmd,rrst): 'fex' option not properly restored * runtime(netrw): remove extraneous closing bracket * 9.1.0740: incorrect internal diff with empty file * 9.1.0739: [security]: use-after-free in ex_getln.c * runtime(filetype): tests: Test_filetype_detection() fails * runtime(dist): do not output a message if executable is not found * 9.1.0738: filetype: rapid files are not recognized * runtime(modconf): remove erroneous :endif in ftplugin * runtime(lyrics): support multiple timestamps in syntax script * runtime(java): Optionally recognise _module_ import declarations * runtime(vim): Update base-syntax, improve folding function matches * CI: upload failed screendump tests also for Cirrus * 9.1.0737: tests: screendump tests may require a bit more time * runtime(misc): simplify keywordprg in various ftplugins * runtime(java): Optionally recognise all primitive constants in _switch-case_ labels * runtime(zsh,sh): set and unset compiler in ftplugin * runtime(netrw): using inefficient highlight pattern for 'mf' * 9.1.0736: Unicode tables are outdated * 9.1.0735: filetype: salt files are not recognized * 9.1.0734: filetype: jinja files are not recognized * runtime(zathurarc): add double-click-follow to syntax script * translation(ru): Updated messages translation * translation(it): updated xxd man page * translation(ru): updated xxd man page * 9.1.0733: keyword completion does not work with fuzzy * 9.1.0732: xxd: cannot use -b and -i together * runtime(java): Highlight javaConceptKind modifiers with StorageClass * runtime(doc): reword and reformat how to use defaults.vim * 9.1.0731: inconsistent case sensitive extension matching * runtime(vim): Update base-syntax, match Vim9 bool/null literal args to :if/:while/:return * runtime(netrw): delete confirmation not strict enough * 9.1.0730: Crash with cursor-screenline and narrow window * 9.1.0729: Wrong cursor-screenline when resizing window * 9.1.0728: [security]: heap-use-after-free in garbage collection with location list user data * runtime(doc): clarify the effect of the timeout for search()-functions * runtime(idlang): update syntax script * runtime(spec): Recognize epoch when making spec changelog in ftplugin * runtime(spec): add file triggers to syntax script * 9.1.0727: too many strlen() calls in option.c * runtime(make): add compiler/make.vim to reset compiler plugin settings * runtime(java): Recognise all available standard doclet tags * 9.1.0726: not using correct python3 API with dynamic linking * runtime(dosini): Update syntax script, spellcheck comments only * runtime(doc): Revert outdated comment in completeopt's fuzzy documentation * 9.1.0725: filetype: swiftinterface files are not recognized * runtime(pandoc): Update compiler plugin to use actual 'spelllang' * runtime(groff): Add compiler plugin for groff * 9.1.0724: if_python: link error with python 3.13 and stable ABI * 9.1.0723: if_python: dynamic linking fails with python3 >= 3.13 * 9.1.0722: crash with large id in text_prop interface * 9.1.0721: tests: test_mksession does not consider XDG_CONFIG_HOME * runtime(glvs): update GetLatestVimScripts plugin * runtime(doc): Fix typo in :help :hide text * runtime(doc): buffers can be re-used * 9.1.0720: Wrong breakindentopt=list:-1 with multibyte or TABs * 9.1.0719: Resetting cell widths can make 'listchars' or 'fillchars' invalid * runtime(doc): Update version9.txt and mention $MYVIMDIR - Update to 9.1.0718: * v9.1.0718: hard to know the users personal Vim Runtime Directory * v9.1.0717: Unnecessary nextcmd NULL checks in parse_command_modifiers() Maintainers: fix typo in author name * v9.1.0716: resetting setcellwidth( doesn't update the screen runtime(hcl,terraform): Add runtime files for HCL and Terraform runtime(tmux): Update syntax script * v9.1.0715: Not correctly parsing color names (after v9.1.0709) * v9.1.0714: GuiEnter_Turkish test may fail * v9.1.0713: Newline causes E749 in Ex mode * v9.1.0712: missing dependency of Test_gettext_makefile * v9.1.0711: test_xxd may file when using different xxd * v9.1.0710: popup window may hide part of Command line runtime(vim): Update syntax, improve user-command matching * v9.1.0709: GUIEnter event not found in Turkish locale runtime(sudoers): improve recognized Runas_Spec and Tag_Spec items * v9.1.0708: Recursive window update does not account for reset skipcol runtime(nu): include filetype plugin * v9.1.0707: invalid cursor position may cause a crash * v9.1.0706: test_gettext fails when using shadow dir CI: Install locales-all package * v9.1.0705: Sorting of fuzzy filename completion is not stable translation(pt): update Portuguese/Brazilian menu translation runtime(vim): Update base-syntax, match bracket mark ranges runtime(doc): Update :help :command-complete list * v9.1.0704: inserting with a count is inefficient runtime(doc): use mkdir -p to save a command * v9.1.0703: crash with 2byte encoding and glob2regpat() runtime(hollywood): update syn highlight for If-Then statements and For-In-Loops * v9.1.0702: Patch 9.1.0700 broke CI * v9.1.0701: crash with NFA regex engine when searching for composing chars * v9.1.0700: crash with 2byte encoding and glob2regpat() * v9.1.0699: "dvgo" is not always an inclusive motion runtime(java): Provide support for syntax preview features * v9.1.0698: "Untitled" file not removed when running Test_crash1_3 alone * v9.1.0697: heap-buffer-overflow in ins_typebuf * v9.1.0696: installing runtime files fails when using SHADOWDIR runtime(doc): fix typo * v9.1.0695: test_crash leaves Untitled file around translation(br): Update Brazilian translation translation(pt): Update menu_pt_br * v9.1.0694: matchparen is slow on a long line * v9.1.0693: Configure doesn't show result when not using python3 stable abi * v9.1.0692: Wrong patlen value in ex_substitute() * v9.1.0691: stable-abi may cause segfault on Python 3.11 runtime(vim): Update base-syntax, match :loadkeymap after colon and bar runtime(mane): Improve ManBS mapping * v9.1.0690: cannot set special highlight kind in popupmenu translation(pt): Revert and fix wrong Portuguese menu translation files translation(pt): revert Portuguese menu translation translation(br): Update Brazilian translations runtime(vim): Update base-syntax, improve :let-heredoc highlighting * v9.1.0689: buffer-overflow in do_search( with 'rightleft' runtime(vim): Improve heredoc handling for all embedded scripts * v9.1.0688: dereferences NULL pointer in check_type_is_value() * v9.1.0687: Makefile may not install desktop files runtime(man): Fix ManBS runtime(java): Make the bundled &foldtext function optional runtime(netrw): Change line on `mx` if command output exists runtime(netrw): Fix `mf`-selected entry highlighting runtime(htmlangular): add html syntax highlighting translation(it): Fix filemode of Italian manpages runtime(doc): Update outdated man.vim plugin information runtime(zip): simplify condition to detect MS-Windows * v9.1.0686: zip-plugin has problems with special characters runtime(pandoc): escape quotes in &errorformat for pandoc translation(it): updated Italian manpage * v9.1.0685: too many strlen( calls in usercmd.c runtime(doc): fix grammar in :h :keeppatterns runtime(pandoc): refine pandoc compiler settings * v9.1.0684: completion is inserted on Enter with "noselect" translation(ru): update man pages * v9.1.0683: mode( returns wrong value with mapping runtime(doc): remove trailing whitespace in cmdline.txt * v9.1.0682: Segfault with uninitialized funcref * v9.1.0681: Analyzing failed screendumps is hard runtime(doc): more clarification for the :keeppatterns needed * v9.1.0680: VMS does not have defined uintptr_t runtime(doc): improve typedchar documentation for KeyInputPre autocmd runtime(dist): verify that executable is in $PATH translation(it): update Italian manpages runtime(doc): clarify the effect of :keeppatterns after * v9.1.0677 runtime(doc): update Makefile and make it portable between GNU and BSD * v9.1.0679: Rename from w_closing to w_locked is incomplete runtime(colors): update colorschemes runtime(vim): Update base-syntax, improve :let-heredoc highlighting runtime(doc): Updating the examples in the xxd manpage translation(ru): Updated uganda.rux runtime(yaml): do not re-indent when commenting out lines * v9.1.0678: use-after-free in alist_add() * v9.1.0677 :keepp does not retain the substitute pattern translation(ja): Update Japanese translations to latest release runtime(netrw): Drop committed trace lines runtime(netrw): Error popup not always used runtime(netrw): ErrorMsg( may throw E121 runtime(tutor): update Makefile and make it portable between GNU and BSD translation: improve the po/cleanup.vim script runtime(lang): update Makefile and make it portable between GNU and BSD * v9.1.0676: style issues with man pages * v9.1.0675: Patch v9.1.0674 causes problems runtime(dosbatch): Show %%i as an argument in syntax file runtime(dosbatch): Add syn-sync to syntax file runtime(sql, mysql): fix E169: Command too recursive with sql_type_default = "mysql" * v9.1.0674: compiling abstract method fails because of missing return runtime(javascript): fix a few issues with syntax higlighting runtime(mediawiki): fix typo in doc, test for b:did_ftplugin var runtime(termdebug): Fix wrong test for balloon feature runtime(doc): Remove mentioning of the voting feature runtime(doc): add help tags for json + markdown global variables * v9.1.0673: too recursive func calls when calling super-class method runtime(syntax-tests): Facilitate the viewing of rendered screendumps runtime(doc): fix a few style issues * v9.1.0672: marker folds may get corrupted on undo * v9.1.0671 Problem: crash with WinNewPre autocommand * v9.1.0670: po file encoding fails on *BSD during make translation(it): Update Italian translation translation: Stop using msgconv * v9.1.0669: stable python ABI not used by default Update .gitignore and .hgignore files * v9.1.0668: build-error with python3.12 and stable ABI translations: Update generated po files * v9.1.0667: Some other options reset curswant unnecessarily when set * v9.1.0666: assert_equal( doesn't show multibyte string correctly runtime(doc): clarify directory of Vim's executable vs CWD * v9.1.0665 :for loop runtime(proto): Add indent script for protobuf filetype * v9.1.0664: console vim did not switch back to main screen on exit runtime(zip): zip plugin does not work with Vim 9.0 * v9.1.0663: zip test still resets 'shellslash' option runtime(zip): use defer to restore old settings runtime(zip): add a generic Message function runtime(zip): increment base version of zip plugin runtime(zip): raise minimum Vim version to * v9.0 runtime(zip): refactor save and restore of options runtime(zip): remove test for fnameescape runtime(zip): use :echomsg instead of :echo runtime(zip): clean up and remove comments * v9.1.0662: filecopy( may return wrong value when readlink( fails * v9.1.0661: the zip plugin is not tested. runtime(zip): Fix for FreeBSD's unzip command runtime(doc): capitalize correctly * v9.1.0660: Shift-Insert does work on old conhost translation(it): update Italian manpage runtime(lua): add/subtract a 'shiftwidth' after '('/')' in indentexpr runtime(zip): escape '[' on Unix as well * v9.1.0659: MSVC Makefile is a bit hard to read runtime(doc): fix typo in syntax.txt runtime(doc): -x is only available when compiled with crypt feature * v9.1.0658: Coverity warns about dereferencing NULL pointer. runtime(colors): update Todo highlight in habamax colorscheme * v9.1.0657: MSVC build time can be optimized * v9.1.0656: MSVC Makefile CPU handling can be improved * v9.1.0655: goaccess config file not recognized CI: update clang compiler to version 20 runtime(netrw): honor `g:netrw_alt{o,v}` for `:{S,H,V}explore` * v9.1.0654: completion does not respect completeslash with fuzzy * v9.1.0653: Patch v9.1.0648 not completely right * v9.1.0652: too many strlen( calls in syntax.c * v9.1.0651 :append * v9.1.0650: Coverity warning in cstrncmp() * v9.1.0649: Wrong comment for "len" argument of call_simple_func() * v9.1.0648: [security] double-free in dialog_changed() * v9.1.0647: [security] use-after-free in tagstack_clear_entry runtime(doc): re-format tag example lines, mention ctags --list-kinds * v9.1.0646: imported function may not be found runtime(java): Document "g:java_space_errors" and "g:java_comment_strings" runtime(java): Cluster optional group definitions and their group links runtime(java): Tidy up the syntax file runtime(java): Tidy up the documentation for "ft-java-syntax" runtime(colors): update habamax scheme - tweak diff/search/todo colors runtime(nohlsearch): add missing loaded_hlsearch guard runtime(kivy): Updated maintainer info for syntax script Maintainers: Add maintainer for ondir ftplugin + syntax files runtime(netrw): removing trailing slash when copying files in same directory * v9.1.0645: wrong match when searching multi-byte char case-insensitive runtime(html): update syntax script to sync by 250 minlines by default * v9.1.0644: Unnecessary STRLEN( when applying mapping runtime(zip): Opening a remote zipfile don't work runtime(cuda): source c and cpp ftplugins * v9.1.0643: cursor may end up on invalid position * v9.1.0642: Check that mapping rhs starts with lhs fails if not simplified * v9.1.0641: OLE enabled in console version runtime(thrift): add ftplugin, indent and syntax scripts * v9.1.0640: Makefile can be improved * v9.1.0639: channel timeout may wrap around * v9.1.0638: E1510 may happen when formatting a message for smsg() * v9.1.0637: Style issues in MSVC Makefile - Update apparmor.vim to latest version (from AppArmor 4.0.2) - add support for "all" and "userns" rules, and new profile flags - Update to 9.1.0636: * 9.1.0636: filetype: ziggy files are not recognized * 9.1.0635: filetype: SuperHTML template files not recognized * 9.1.0634: Ctrl-P not working by default * 9.1.0633: Compilation warnings with `-Wunused-parameter` * 9.1.0632: MS-Windows: Compiler Warnings Add support for Files-Included in syntax script tweak documentation style a bit * 9.1.0631: wrong completion list displayed with non-existing dir + fuzzy completion * 9.1.0630: MS-Windows: build fails with VIMDLL and mzscheme * 9.1.0629: Rename of pum hl_group is incomplete * 9.1.0628: MinGW: coverage files are not cleaned up * 9.1.0627: MinGW: build-error when COVERAGE is enabled * 9.1.0626: Vim9: need more tests with null objects include initial filetype plugin * 9.1.0625: tests: test output all translated messages for all translations * 9.1.0624: ex command modifiers not found * 9.1.0623: Mingw: errors when trying to delete non-existing files * 9.1.0622: MS-Windows: mingw-build can be optimized * 9.1.0621: MS-Windows: startup code can be improved * 9.1.0620: Vim9: segfauls with null objects * 9.1.0619: tests: test_popup fails * 9.1.0618: cannot mark deprecated attributes in completion menu * 9.1.0617: Cursor moves beyond first line of folded end of buffer * 9.1.0616: filetype: Make syntax highlighting off for MS Makefiles * 9.1.0615: Unnecessary STRLEN() in make_percent_swname() Add single-line comment syntax Add syntax test for comments Update maintainer info * 9.1.0614: tests: screendump tests fail due to recent syntax changes * 9.1.0613: tests: termdebug test may fail and leave file around Update base-syntax, improve :set highlighting Optionally highlight the :: token for method references * 9.1.0612: filetype: deno.lock file not recognized Use delete() for deleting directory escape filename before trying to delete it * 9.1.0611: ambiguous mappings not correctly resolved with modifyOtherKeys correctly extract file from zip browser * 9.1.0610: filetype: OpenGL Shading Language files are not detected Fix endless recursion in netrw#Explore() * 9.1.0609: outdated comments in Makefile update syntax script Fix flow mapping key detection Remove orphaned YAML syntax dump files * 9.1.0608: Coverity warns about a few potential issues Update syntax script and remove syn sync * 9.1.0607: termdebug: uses inconsistent style * 9.1.0606: tests: generated files may cause failure in test_codestyle * 9.1.0605: internal error with fuzzy completion * 9.1.0604: popup_filter during Press Enter prompt seems to hang translation: Update Serbian messages translation * 9.1.0603: filetype: use correct extension for Dracula * 9.1.0602: filetype: Prolog detection can be improved fix more inconsistencies in assert function docs * 9.1.0601: Wrong cursor position with 'breakindent' when wide char doesn't fit Update base-syntax, improve :map highlighting * 9.1.0600: Unused function and unused error constants * 9.1.0599: Termdebug: still get E1023 when specifying arguments correct wrong comment options fix typo "a xterm" -> "an xterm" * 9.1.0598: fuzzy completion does not work with default completion * 9.1.0597: KeyInputPre cannot get the (unmapped typed) key * 9.1.0596: filetype: devscripts config files are not recognized gdb file/folder check is now performed only in CWD. quote filename arguments using double quotes update syntax to SDC-standard 2.1 minor updates. Cleanup :match and :loadkeymap syntax test files Update base-syntax, match types in Vim9 variable declarations * 9.1.0595: make errors out with the po Makefile * 9.1.0594: Unnecessary redraw when setting 'winfixbuf' using wrong highlight for UTF-8 include simple syntax plugin * 9.1.0593: filetype: Asymptote files are not recognized add recommended indent options to ftplugin add recommended indent options to ftplugin add recommended indent options to ftplugin * 9.1.0592: filetype: Mediawiki files are not recognized * 9.1.0591: filetype: *.wl files are not recognized * 9.1.0590: Vim9: crash when accessing getregionpos() return value 'cpoptions': Include "z" in the documented default * 9.1.0589: vi: d{motion} and cw work differently than expected update included colorschemes grammar fixes in options.txt - Add "Keywords" to gvim.desktop to make searching for gvim easier - Removed patches, as they're no longer required (refreshing them deleted their contents): * vim-7.3-help_tags.patch * vim-7.4-highlight_fstab.patch - Reorganise all applied patches in the spec file. - Update to 9.1.0588: * 9.1.0588: The maze program no longer compiles on newer clang runtime(typst): Add typst runtime files * 9.1.0587: tests: Test_gui_lowlevel_keyevent is still flaky * 9.1.0586: ocaml runtime files are outdated runtime(termdebug): fix a few issues * 9.1.0585: tests: test_cpoptions leaves swapfiles around * 9.1.0584: Warning about redeclaring f_id() non-static runtime(doc): Add hint how to load termdebug from vimrc runtime(doc): document global insert behavior * 9.1.0583: filetype: *.pdf_tex files are not recognized * 9.1.0582: Printed line doesn't overwrite colon when pressing Enter in Ex mode * 9.1.0581: Various lines are indented inconsistently * 9.1.0580: :lmap mapping for keypad key not applied when typed in Select mode * 9.1.0579: Ex command is still executed after giving E1247 * 9.1.0578: no tests for :Tohtml * 9.1.0577: Unnecessary checks for v:sizeoflong in test_put.vim * 9.1.0576: tests: still an issue with test_gettext_make * 9.1.0575: Wrong comments in alt_tabpage() * 9.1.0574: ex: wrong handling of commands after bar runtime(doc): add a note for netrw bug reports * 9.1.0573: ex: no implicit print for single addresses runtime(vim): make &indentexpr available from the outside * 9.1.0572: cannot specify tab page closing behaviour runtime(doc): remove obsolete Ex insert behavior * 9.1.0571: tests: Test_gui_lowlevel_keyevent is flaky runtime(logindefs): update syntax with new keywords * 9.1.0570: tests: test_gettext_make can be improved runtime(filetype): Fix Prolog file detection regex * 9.1.0569: fnamemodify() treats ".." and "../" differently runtime(mojo): include mojo ftplugin and indent script * 9.1.0568: Cannot expand paths from 'cdpath' setting * 9.1.0567: Cannot use relative paths as findfile() stop directories * 9.1.0566: Stop dir in findfile() doesn't work properly w/o trailing slash * 9.1.0565: Stop directory doesn't work properly in 'tags' * 9.1.0564: id() can be faster * 9.1.0563: Cannot process any Key event * 9.1.0562: tests: inconsistency in test_findfile.vim runtime(fstab): Add missing keywords to fstab syntax * 9.1.0561: netbeans: variable used un-initialized (Coverity) * 9.1.0560: bindtextdomain() does not indicate an error * 9.1.0559: translation of vim scripts can be improved * 9.1.0558: filetype: prolog detection can be improved * 9.1.0557: moving in the buffer list doesn't work as documented runtime(doc): fix inconsistencies in :h file-searching * 9.1.0556: :bwipe doesn't remove file from jumplist of other tabpages runtime(htmlangular): correct comment * 9.1.0555: filetype: angular ft detection is still problematic * 9.1.0554: :bw leaves jumplist and tagstack data around * 9.1.0553: filetype: *.mcmeta files are not recognized * 9.1.0552: No test for antlr4 filetype * 9.1.0551: filetype: htmlangular files are not properly detected * 9.1.0550: filetype: antlr4 files are not recognized * 9.1.0549: fuzzycollect regex based completion not working as expected runtime(doc): autocmd_add() accepts a list not a dict * 9.1.0548: it's not possible to get a unique id for some vars runtime(tmux): Update syntax script * 9.1.0547: No way to get the arity of a Vim function * 9.1.0546: vim-tiny fails on CTRL-X/CTRL-A runtime(hlsplaylist): include hlsplaylist ftplugin file runtime(doc): fix typo in :h ft-csv-syntax runtime(doc): Correct shell command to get $VIMRUNTIME into shell * 9.1.0545: MSVC conversion warning * 9.1.0544: filetype: ldapconf files are not recognized runtime(cmakecache): include cmakecache ftplugin file runtime(lex): include lex ftplugin file runtime(yacc): include yacc ftplugin file runtime(squirrel): include squirrel ftplugin file runtime(objcpp): include objcpp ftplugin file runtime(tf): include tf ftplugin file runtime(mysql): include mysql ftplugin file runtime(javacc): include javacc ftplugin file runtime(cabal): include cabal ftplugin file runtime(cuda): include CUDA ftplugin file runtime(editorconfig): include editorconfig ftplugin file runtime(kivy): update kivy syntax, include ftplugin runtime(syntax-tests): Stop generating redundant "*_* 99.dump" files * 9.1.0543: Behavior of CursorMovedC is strange runtime(vim): Update base-syntax, improve :match command highlighting * 9.1.0542: Vim9: confusing string() output for object functions * 9.1.0541: failing test with Vim configured without channel * 9.1.0540: Unused assignment in sign_define_cmd() runtime(doc): add page-scrolling keys to index.txt runtime(doc): add reference to xterm-focus-event from FocusGained/Lost * 9.1.0539: Not enough tests for what v9.1.0535 fixed runtime(doc): clarify how to re-init csv syntax file * 9.1.0538: not possible to assign priority when defining a sign * 9.1.0537: signed number detection for CTRL-X/A can be improved * 9.1.0536: filetype: zone files are not recognized * 9.1.0535: newline escape wrong in ex mode runtime(man): honor cmd modifiers before `g:ft_man_open_mode` runtime(man): use `nnoremap` to map to Ex commands * 9.1.0534: completion wrong with fuzzy when cycling back to original runtime(syntax-tests): Abort and report failed cursor progress runtime(syntax-tests): Introduce self tests for screen dumping runtime(syntax-tests): Clear and redraw the ruler line with the shell info runtime(syntax-tests): Allow for folded and wrapped lines in syntax test files * 9.1.0533: Vim9: need more tests for nested objects equality CI: Pre-v* 9.0.0110 versions generate bogus documentation tag entries runtime(doc): Remove wrong help tag CTRL-SHIFT-CR * 9.1.0532: filetype: Cedar files not recognized runtime(doc): document further keys that scroll page up/down * 9.1.0531: resource leak in mch_get_random() runtime(tutor): Fix wrong spanish translation runtime(netrw): fix remaining case of register clobber * 9.1.0530: xxd: MSVC warning about non-ASCII character * 9.1.0529: silent! causes following try/catch to not work runtime(rust): use shiftwidth() in indent script * 9.1.0528: spell completion message still wrong in translations * 9.1.0527: inconsistent parameter in Makefiles for Vim executable * 9.1.0526: Unwanted cursor movement with pagescroll at start of buffer runtime(doc): mention $XDG_CONFIG_HOME instead of $HOME/.config * 9.1.0525: Right release selects immediately when pum is truncated. * 9.1.0524: the recursive parameter in the *_equal functions can be removed runtime(termdebug): Add Deprecation warnings * 9.1.0523: Vim9: cannot downcast an object * 9.1.0522: Vim9: string(object) hangs for recursive references * 9.1.0521: if_py: _PyObject_CallFunction_SizeT is dropped in Python 3.13 * 9.1.0520: Vim9: incorrect type checking for modifying lists runtime(manpager): avoid readonly prompt * 9.1.0519: MS-Windows: libvterm compilation can be optimized * 9.1.0518: initialize the random buffer can be improved * 9.1.0517: MS-Windows: too long lines in Make_mvc.mak runtime(terraform): Add filetype plugin for terraform runtime(dockerfile): enable spellchecking of comments in syntax script runtime(doc): rename variable for pandoc markdown support runtime(doc): In builtin overview use {buf} as param for appendbufline/setbufline runtime(doc): clarify, that register 1-* 9 will always be shifted runtime(netrw): save and restore register 0-* 9, a and unnamed runtime(termdebug): Refactored StartDebug_term and EndDebug functions runtime(java): Compose "g:java_highlight_signature" and "g:java_highlight_functions" * 9.1.0516: need more tests for nested dicts and list comparision * 9.1.0515: Vim9: segfault in object_equal() * 9.1.0514: Vim9: issue with comparing objects recursively runtime(termdebug): Change some variables to Enums runtime(vim): Update base-syntax, fix function tail comments * 9.1.0513: Vim9: segfault with object comparison - Update to 9.1.0512: * Mode message for spell completion doesn't match allowed keys * CursorMovedC triggered wrongly with setcmdpos() * update runtime files * CI: test_gettext fails on MacOS14 + MSVC Win * not possible to translate Vim script messages * termdebug plugin can be further improved * add gomod filetype plugin * hard to detect cursor movement in the command line * Optionally highlight parameterised types * filetype: .envrc & .prettierignore not recognized * filetype: Faust files are not recognized * inner-tag textobject confused about ">" in attributes * cannot use fuzzy keyword completion * Remove the group exclusion list from @javaTop * wrong return type for execute() function * MS-Windows: too much legacy code * too complicated mapping restore in termdebug * simplify mapping * cannot switch buffer in a popup * MS-Windows: doesn't handle symlinks properly * getcmdcompltype() interferes with cmdline completion * termdebug can be further improved * update htmldjango detection * Improve Turkish documentation * include a simple csv filetype and syntax plugin * include the the simple nohlsearch package * matched text is highlighted case-sensitively * Matched text isn't highlighted in cmdline pum * Fix typos in several documents * clarify when text properties are cleared * improve the vim-shebang example * revert unintended formatting changes for termdebug * Add a config variable for commonly used compiler options * Wrong matched text highlighted in pum with 'rightleft' * bump length of character references in syntax script * properly check mapping variables using null_dict * fix KdlIndent and kdlComment in indent script * Test for patch 9.1.0489 doesn't fail without the fix * Fold multi-line comments with the syntax kind of &fdm * using wrong type for PlaceSign() * filetype: Vim-script files not detected by shebang line * revert unintended change to zip#Write() * add another tag for vim-shebang feature * Cmdline pum doesn't work properly with 'rightleft' * minor style problems with patch 9.1.0487 * default completion may break with fuzzy * Wrong padding for pum "kind" with 'rightleft' * Update base-syntax, match shebang lines * MS-Windows: handle files with spaces properly * Restore HTML syntax file tests * completed item not update on fuzzy completion * filetype: Snakemake files are not recognized * make TermDebugSendCommand() a global function again * close all buffers in the same way * Matched text shouldn't be highlighted in "kind" and "menu" * fix wrong helptag for :defer * Update base-syntax, match :sleep arg * include Georgian keymap * Sorting of completeopt+=fuzzy is not stable * correctly test for windows in NetrwGlob() * glob() on windows fails with [] in directory name * rewrite mkdir() doc and simplify {flags} meaning * glob() not sufficiently tested * update return type for job_info() * termdebug plugin needs more love * correct return types for job_start() and job_status() * Update base-syntax, match :catch and :throw args * Include element values in non-marker annotations * Vim9: term_getjob() throws an exception on error * fuzzy string matching executed when not needed * fuzzy_match_str_with_pos() does unnecessary list operations * restore description of "$" in col() and virtcol() * deduplicate getpos(), line(), col(), virtcol() * Update g:vimsyn_comment_strings dump file tests * Use string interpolation instead of string concat * potential deref of NULL pointer in fuzzy_match_str_with_pos * block_editing errors out when using * Update base-syntax, configurable comment string highlighting * fix typos in syntax.txt * Cannot see matched text in popup menu * Update base-syntax, match multiline continued comments * clarify documentation for "v" position at line() * cmod_split modifier is always reset in term_start() * remove line-continuation characters * use shiftwidth() instead of &tabstop in indent script * Remove orphaned screen dump files * include syntax, indent and ftplugin files * CI: Test_ColonEight() fails on github runners * add missing Enabled field in syntax script * basic svelte ftplugin file * term_start() does not clear vertical modifier * fix mousemodel restoration by comparing against null_string * Added definitions of Vim scripts and plugins * Exclude lambda expressions from _when_ _switch-case_ label clauses * Fix saved_mousemodel check * Inconsistencies between functions for option flags * Crash when using autocmd_get() after removing event inside autocmd * Fix small style issues * add return type info for Vim function descriptions * Update Italian Vim manpage * disable the q mapping * Change 'cms' for C++ to '// %s' * fix type mismatch error * Fix wrong email address * convert termdebug plugin to Vim9 script - Update to 9.1.0470: * tests Test_ColonEight_MultiByte() fails sporadically * Cannot have buffer-local value for 'completeopt' * GvimExt does not consult HKEY_CURRENT_USER * typos in some comments * runtime(vim): Update base-syntax, allow whitespace before :substitute pattern * Missing comments for fuzzy completion * runtime(man): update Vim manpage * runtime(comment): clarify the usage of 'commentstring' option value * runtime(doc): clarify how fuzzy 'completeopt' should work * runtime(netrw): prevent accidental data loss * missing filecopy() function * no whitespace padding in commentstring option in ftplugins * no fuzzy-matching support for insert-completion * eval5() and eval7 are too complex * too many strlen() calls in drawline.c * filetype lintstagedrc files are not recognized * Vim9 import autoload does not work with symlink * Coverity complains about division by zero * tests test_gui fails on Wayland * Left shift is incorrect with vartabstop and shiftwidth=0 * runtime(doc): clarify 'shortmess' flag "S" * MS-Windows compiler warning for size_t to int conversion * runtime(doc): include some vim9 script examples in the help * minor issues in test_filetype with rasi test * filetype rasi files are not recognized * runtime(java): Improve the matching of lambda expressions * Configure checks for libelf unnecessarily * No test for escaping '<' with shellescape() * check.vim complains about overlong comment lines * translation(it): Update Italian translation * evalc. code too complex * MS-Windows Compiler warnings - Update to 9.1.0448: * compiler warning in eval.c * remove remaining css code * Add ft_hare.txt to Reference Manual TOC * re-generate vim syntax from generator * fix syntax vim bug * completion may be wrong when deleting all chars * getregionpos() inconsistent for partly-selected multibyte char * fix highlighting nested and escaped quotes in string props * remove the indent plugin since it has too many issues * update Debian runtime files * Coverity warning after 9.1.0440 * Not enough tests for getregion() with multibyte chars * Can't use blockwise selection with width for getregion() * update outdated syntax files * fix floating_modifier highlight * hare runtime files outdated * getregionpos() can't properly indicate positions beyond eol * function get_lval() is too long * Cannot filter the history * Wrong Ex command executed when :g uses '?' as delimiter * support floating_modifier none; revert broken highlighting * Motif requires non-const char pointer for XPM data * Crash when using '?' as separator for :s * filetype: cygport files are not recognized * make errors trying to access autoload/zig * Wrong yanking with exclusive selection and ve=all * add missing help tags file * Ancient XPM preprocessor hack may cause build errors * include basic rescript ftplugin file * eval.c is too long * getregionpos() doesn't handle one char selection * check for gdb file/dir before using as buffer name * refactor zig ftplugin, remove auto format * Coverity complains about eval.c refactor * Tag guessing leaves wrong search history with very short names * some issues with termdebug mapping test * update matchit plugin to v1.20 * too many strlen() calls in search.c * set commentstring option * update vb indent plugin as vim9script * filetype: purescript files are not recognized * filetype: slint files are not recognized * basic nim ftplugin file for comments * Add Arduino ftplugin and indent files * include basic typst ftplugin file * include basic prisma ftplugin file * include basic v ftplugin for comment support * getregionpos() wrong with blockwise mode and multibyte * function echo_string_core() is too long * hyprlang files are not recognized * add basic dart ftplugin file * basic ftplugin file for graphql * mention comment plugin at :h 'commentstring' * set commentstring for sql files in ftplugin * :browse oldfiles prompts even with single entry * eval.c not sufficiently tested * clarify why E195 is returned * clarify temporary file clean up * fix :NoMatchParen not working * Cannot move to previous/next rare word * add basic ftplugin file for sshdconfig * if_py: find_module has been removed in Python 3.12.0a7 * some screen dump tests can be improved * Some functions are not tested * clarify instal instructions for comment package * Unable to leave long line with 'smoothscroll' and 'scrolloff' * fix typo in vim9script help file * Remove trailing spaces * clarify {special} argument for shellescape() - update to 9.1.0413 * smoothscroll may cause infinite loop * add missing entries for the keys CTRL-W g and * update vi_diff.txt: add default value for 'flash' * typo in regexp_bt.c in DEBUG code * allow indented commands * Fix wrong define regex in ftplugin * Filter out non-Latin-1 characters for syntax tests * prefer scp over pscp * fix typo in usr_52.txt * too long functions in eval.c * warning about uninitialized variable * too many strlen() calls in the regexp engine * E16 fix, async keyword support for define * Stuck with long line and half-page scrolling * Divide by zero with getmousepos() and 'smoothscroll' * update and remove some invalid links * update translation of xxd manpage * Recursively delete directories by default with netrw delete command * Strive to remain compatible for at least Vim 7.0 * tests: xxd buffer overflow fails on 32-bit * Stop handpicking syntax groups for @javaTop * [security] xxd: buffer-overflow with specific flags * Vim9: not able to import file from start dir * filetype: mdd files detected as zsh filetype * filetype: zsh module files are not recognized * Remove hardcoded private.ppk logic from netrw * Vim9: confusing error message for unknown type * block_editing errors out when using del * add new items to scripts section in syntax plugin * Vim9: imported vars are not properly type checked * Wrong display with 'smoothscroll' when changing quickfix list * filetype: jj files are not recognized * getregionpos() may leak memory on error * The CODEOWNERS File is not useful * Remove and cleanup Win9x legacy from netrw * add MsgArea to 'highlight' option description * Cannot get a list of positions describing a region * Fix digit separator in syntax script for octals and floats * Update link to Wikipedia Vi page * clear $MANPAGER in ftplugin before shelling out * Fix typos in help documents * 'viewdir' not respecting $XDG_CONFIG_HOME * tests: Vim9 debug tests may be flaky * correct getscriptinfo() example * Vim9: could improve testing * test_sound fails on macos-12 * update Serbian menu * update Slovak menu * update Slovenian menu * update Portuguese menu * update Dutch menu * update Korean menu * update Icelandic menu * update Czech menu * update Afrikaans menu * update German menu * filetype: inko files are not recognized * filetype: templ files are not recognized * cursor() and getregion() don't handle v:maxcol well * Vim9: null value tests not sufficient * update Catalan menu * filetype: stylus files not recognized * update spanish menu localization * regenerate helptags * Vim9: crash with null_class and null_object * Add tags about lazyloading of menu * tests: vt420 terminfo entry may not be found * filetype: .out files recognized as tex files * filetype: Kbuild files are not recognized * cbuffer and similar commands don't accept a range * Improve the recognition of the "indent" method declarations * Fix a typo in usr_30.txt * remove undefined var s:save_cpoptions and add include setting * missing setlocal in indent plugin * Calculating line height for unnecessary amount of lines * improve syntax file performance * There are a few typos * Vim9: no comments allowed after class vars * CI: remove trailing white space in documentation * Formatting text wrong when 'breakindent' is set * Add oracular (24.10) as Ubuntu release name * Vim9: Trailing commands after class/enum keywords ignored * tests: 1-second delay after Test_BufEnter_botline() * update helptags for jq syntax * include syntax, ftplugin and compiler plugin * fix typo synconcealend -> synconcealed * include a simple comment toggling plugin * wrong botline in BufEnter * clarify syntax vs matching mechanism * fix undefined variable in indent plugin * ops.c code uses too many strlen() calls * Calling CLEAR_FIELD() on the same struct twice * Vim9: compile_def_function() still too long * Update Serbian messages * clarify the effect of setting the shell to powershell * Improve the recognition of the "style" method declarations * Vim9: problem when importing autoloaded scripts * compile_def_function is too long * filetype: ondir files are not recognized * Crash when typing many keys with D- modifier * tests: test_vim9_builtin is a bit slow * update documentation * change the download URL of "libsodium" * tests: test_winfixbuf is a bit slow * Add filetype, syntax and indent plugin for Astro * expanding rc config files does not work well * Vim9: vim9type.c is too complicated * Vim9: does not handle autoloaded variables well * minor spell fix in starting.txt * wrong drawing in GUI with setcellwidth() * Add include and suffixesadd * Page scrolling should place cursor at window boundaries * align command line table * minor fixes to starting.txt * fix comment definition in filetype plugin * filetype: flake.lock files are not recognized * runtime(uci): No support for uci file types * Support "g:ftplugin_java_source_path" with archived files * tests: Test_autoload_import_relative_compiled fails on Windows * Finding cmd modifiers and cmdline-specials is inefficient * No test that completing a partial mapping clears 'showcmd' * tests: test_vim9_dissamble may fail * Vim9: need static type for typealias * X11 does not ignore smooth scroll event * A few typos in test_xdg when testing gvimrc * Patch v9.1.0338 fixed sourcing a script with import * Problem: gvimrc not sourced from XDG_CONFIG_HOME * Cursor wrong after using setcellwidth() in terminal * 'showcmd' wrong for partial mapping with multibyte * tests: test_taglist fails when 'helplang' contains non-english * Problem: a few memory leaks are found * Problem: Error with matchaddpos() and empty list * tests: xdg test uses screen dumps * Vim9: import through symlinks not correctly handled * Missing entry for XDG vimrc file in :version * tests: typo in test_xdg * runtime(i3config/swayconfig): update syntax scripts * document pandoc compiler and enable configuring arguments * String interpolation fails for List type * No test for highlight behavior with 'ambiwidth' * tests: test_xdg fails on the appimage repo * tests: some assert_equal() calls have wrong order of args * make install does not install all files * runtime(doc): fix typos in starting.txt- Updated to version 9.1 with patch level 0330, fixes the following problems * Fixing bsc#1220763 - vim gets Segmentation fault after updating to version 9.1.0111-150500.20.9.1 - refreshed vim-7.3-filetype_spec.patch - refreshed vim-7.3-filetype_ftl.patch - Update spec.skeleton to use autosetup in place of setup macro. - for the complete list of changes see https://github.com/vim/vim/compare/v9.1.0111...v9.1.0330- Updated to version 9.1 with patch level 0111, fixes the following security problems * Fixing bsc#1217316 (CVE-2023-48231) - VUL-0: CVE-2023-48231: vim: Use-After-Free in win_close() * Fixing bsc#1217320 (CVE-2023-48232) - VUL-0: CVE-2023-48232: vim: Floating point Exception in adjust_plines_for_skipcol() * Fixing bsc#1217321 (CVE-2023-48233) - VUL-0: CVE-2023-48233: vim: overflow with count for :s command * Fixing bsc#1217324 (CVE-2023-48234) - VUL-0: CVE-2023-48234: vim: overflow in nv_z_get_count * Fixing bsc#1217326 (CVE-2023-48235) - VUL-0: CVE-2023-48235: vim: overflow in ex address parsing * Fixing bsc#1217329 (CVE-2023-48236) - VUL-0: CVE-2023-48236: vim: overflow in get_number * Fixing bsc#1217330 (CVE-2023-48237) - VUL-0: CVE-2023-48237: vim: overflow in shift_line * Fixing bsc#1217432 (CVE-2023-48706) - VUL-0: CVE-2023-48706: vim: heap-use-after-free in ex_substitute * Fixing bsc#1219581 (CVE-2024-22667) - VUL-0: CVE-2024-22667: vim: stack-based buffer overflow in did_set_langmap function in map.c * Fixing bsc#1215005 (CVE-2023-4750) - VUL-0: CVE-2023-4750: vim: Heap use-after-free in function bt_quickfix - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.2103...v9.1.0111- Updated to version 9.0 with patch level 2103, fixes the following security problems * Fixing bsc#1215940 (CVE-2023-5344) - VUL-0: CVE-2023-5344: vim: Heap-based Buffer Overflow in vim prior to 9.0.1969. * Fixing bsc#1216001 (CVE-2023-5441) - VUL-0: CVE-2023-5441: vim: segfault in exmode when redrawing * Fixing bsc#1216167 (CVE-2023-5535) - VUL-0: CVE-2023-5535: vim: use-after-free from buf_contents_changed() * Fixing bsc#1216696 (CVE-2023-46246) - VUL-0: CVE-2023-46246: vim: Integer Overflow in :history command * Fixing bsc#1214922 (CVE-2023-4738) - VUL-0: CVE-2023-4738: vim: heap-buffer-overflow in vim_regsub_both * Fixing bsc#1214924 (CVE-2023-4735) - VUL-0: CVE-2023-4735: vim: OOB Write ops.c * Fixing bsc#1214925 (CVE-2023-4734) - VUL-0: CVE-2023-4734: vim: segmentation fault in function f_fullcommand * Fixing bsc#1215004 (CVE-2023-4733) - VUL-0: CVE-2023-4733: vim: use-after-free in function buflist_altfpos * Fixing bsc#1215006 (CVE-2023-4752) - VUL-0: CVE-2023-4752: vim: Heap Use After Free in function ins_compl_get_exp * Fixing bsc#1215033 (CVE-2023-4781) - VUL-0: CVE-2023-4781: vim: heap-buffer-overflow in function vim_regsub_both - drop patches: disable-unreliable-tests.patch ignore-flaky-test-failure.patch vim-8.1.0297-dump3.patch - dropped %check - most of tests didn't work correctly in OBS and maintenance burden of this was getting too big - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.1632...v9.0.2103- Use app icon generated from vimlogo.eps in source tarball; add higher res icons of sizes 128, 256, and 512px as png sources. Our current icons deviate from upstream flatpaks for example. - Updated to version 9.0 with patch level 1632 - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.1443...v9.0.1632- Updated to version 9.0 with patch level 1572, fixes the following security problems * Fixing bsc#1210996 (CVE-2023-2426) - VUL-0: CVE-2023-2426: vim: Use of Out-of-range Pointer Offset in GitHub repository vim/vim prior to 9.0.1499. * Fixing bsc#1211256 (CVE-2023-2609) - VUL-1: CVE-2023-2609: vim: NULL Pointer Dereference prior to 9.0.1531 * Fixing bsc#1211257 (CVE-2023-2610) - VUL-1: CVE-2023-2610: vim: Integer Overflow or Wraparound prior to 9.0.1532 - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.1443...v9.0.1572- Fixing bsc#1211461 - L3: vim "eats" first character from prompt in xterm * Add: reorder-exit-raw-mode.patch * Swaps out_str_t_TE() and cursor_on() during exit to prevent missing characters in xterm prompt on exit.- Fixing bsc#1211144 - [Build 96.1] openQA test fails in zypper_migration - conflict between xxd and vim * Revert the creation standalone xxd packages- Updated to version 9.0 with patch level 1443, fixes the following security problems * Fixing bsc#1209042 (CVE-2023-1264) - VUL-0: CVE-2023-1264: vim: NULL Pointer Dereference vim prior to 9.0.1392 * Fixing bsc#1209187 (CVE-2023-1355) - VUL-0: CVE-2023-1355: vim: NULL Pointer Dereference prior to 9.0.1402. * Fixing bsc#1208828 (CVE-2023-1127) - VUL-1: CVE-2023-1127: vim: divide by zero in scrolldown() - drop vim-8.0-ttytype-test.patch as it changes test_options.vim which we remove during %prep anyway. And this breaks quilt setup. - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.1386...v9.0.1443- Updated to version 9.0 with patch level 1386, fixes the following security problems * Fixing bsc#1207780 - (CVE-2023-0512) VUL-0: CVE-2023-0512: vim: Divide By Zero in GitHub repository vim/vim prior to 9.0.1247 * Fixing bsc#1208957 - (CVE-2023-1175) VUL-0: CVE-2023-1175: vim: Incorrect Calculation of Buffer Size * Fixing bsc#1208959 - (CVE-2023-1170) VUL-0: CVE-2023-1170: vim: Heap-based Buffer Overflow in vim prior to 9.0.1376 * Fixing bsc#1208828 - (CVE-2023-1127) VUL-1: CVE-2023-1127: vim: divide by zero in scrolldown() - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.1234...v9.0.1386- Updated to version 9.0 with patch level 1234, fixes the following security problems * Fixing bsc#1207396 VUL-0: CVE-2023-0433: vim: Heap-based Buffer Overflow in vim prior to 9.0.1225 * Fixing bsc#1207162 VUL-1: CVE-2023-0288: vim: Heap-based Buffer Overflow in GitHub repository vim/vim prior to 9.0.1189. * Fixing bsc#1206868 VUL-1: CVE-2023-0054: vim: Out-of-bounds Write in GitHub repository vim/vim prior to 9.0.1145. * Fixing bsc#1206867 VUL-1: CVE-2023-0051: vim: Heap-based Buffer Overflow in GitHub repository vim/vim prior to 9.0.1144. * Fixing bsc#1206866 VUL-1: CVE-2023-0049: vim: Out-of-bounds Read in GitHub repository vim/vim prior to 9.0.1143. - refreshed vim-7.4-highlight_fstab.patch - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.1040...v9.0.1234- Updated to version 9.0 with patch level 1040, fixes the following security problems * Fixing bsc#1206028 VUL-0: CVE-2022-3491: vim: Heap-based Buffer Overflow prior to 9.0.0742 * Fixing bsc#1206071 VUL-0: CVE-2022-3520: vim: Heap-based Buffer Overflow * Fixing bsc#1206072 VUL-0: CVE-2022-3591: vim: Use After Free * Fixing bsc#1206075 VUL-0: CVE-2022-4292: vim: Use After Free in GitHub repository vim/vim prior to 9.0.0882. * Fixing bsc#1206077 VUL-0: CVE-2022-4293: vim: Floating Point Comparison with Incorrect Operator in GitHub repository vim/vim prior to 9.0.0804. * Fixing bsc#1205797 VUL-0: CVE-2022-4141: vim: heap-buffer-overflow in alloc.c 246:11 * Fixing bsc#1204779 VUL-0: CVE-2022-3705: vim: use after free in function qf_update_buffer of the file quickfix.c - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.814...v9.0.1040- Updated to version 9.0 with patch level 0814, fixes the following problems * Fixing bsc#1192478 VUL-1: CVE-2021-3928: vim: vim is vulnerable to Stack-based Buffer Overflow * Fixing bsc#1203508 VUL-0: CVE-2022-3234: vim: Heap-based Buffer Overflow prior to 9.0.0483. * Fixing bsc#1203509 VUL-1: CVE-2022-3235: vim: Use After Free in GitHub prior to 9.0.0490. * Fixing bsc#1203820 VUL-0: CVE-2022-3324: vim: Stack-based Buffer Overflow in prior to 9.0.0598. * Fixing bsc#1204779 VUL-0: CVE-2022-3705: vim: use after free in function qf_update_buffer of the file quickfix.c * Fixing bsc#1203152 VUL-1: CVE-2022-2982: vim: use after free in qf_fill_buffer() * Fixing bsc#1203796 VUL-1: CVE-2022-3296: vim: stack out of bounds read in ex_finally() in ex_eval.c * Fixing bsc#1203797 VUL-1: CVE-2022-3297: vim: use-after-free in process_next_cpt_value() at insexpand.c * Fixing bsc#1203110 VUL-1: CVE-2022-3099: vim: Use After Free in ex_docmd.c * Fixing bsc#1203194 VUL-1: CVE-2022-3134: vim: use after free in do_tag() * Fixing bsc#1203272 VUL-1: CVE-2022-3153: vim: NULL Pointer Dereference in GitHub repository vim/vim prior to 9.0.0404. * Fixing bsc#1203799 VUL-1: CVE-2022-3278: vim: NULL pointer dereference in eval_next_non_blank() in eval.c * Fixing bsc#1203924 VUL-1: CVE-2022-3352: vim: vim: use after free * Fixing bsc#1203155 VUL-1: CVE-2022-2980: vim: null pointer dereference in do_mouse() * Fixing bsc#1202962 VUL-1: CVE-2022-3037: vim: Use After Free in vim prior to 9.0.0321 - ignore-flaky-test-failure.patch: Ignore failure of flaky tests - disable-unreliable-tests-arch.patch: Removed - for the complete list of changes see https://github.com/vim/vim/compare/v9.0.0313...v9.0.0814- Updated to version 9.0 with patch level 0313, fixes the following problems * Fixing bsc#1200884 Vim: Error on startup * Fixing bsc#1200902 VUL-0: CVE-2022-2183: vim: Out-of-bounds Read through get_lisp_indent() Mon 13:32 * Fixing bsc#1200903 VUL-0: CVE-2022-2182: vim: Heap-based Buffer Overflow through parse_cmd_address() Tue 08:37 * Fixing bsc#1200904 VUL-0: CVE-2022-2175: vim: Buffer Over-read through cmdline_insert_reg() Tue 08:37 * Fixing bsc#1201249 VUL-0: CVE-2022-2304: vim: stack buffer overflow in spell_dump_compl() * Fixing bsc#1201356 VUL-1: CVE-2022-2343: vim: Heap-based Buffer Overflow in GitHub repository vim prior to 9.0.0044 * Fixing bsc#1201359 VUL-1: CVE-2022-2344: vim: Another Heap-based Buffer Overflow vim prior to 9.0.0045 * Fixing bsc#1201363 VUL-1: CVE-2022-2345: vim: Use After Free in GitHub repository vim prior to 9.0.0046. * Fixing bsc#1201620 PUBLIC SUSE Linux Enterprise Server 15 SP4 Basesystem zbalogh@suse.com NEW --- SLE-15-SP4-Full-x86_64-GM-Media1 and vim-plugin-tlib-1.27-bp154.2.18.noarch issue * Fixing bsc#1202414 VUL-1: CVE-2022-2819: vim: Heap-based Buffer Overflow in compile_lock_unlock() * Fixing bsc#1202552 VUL-1: CVE-2022-2874: vim: NULL Pointer Dereference in generate_loadvar() * Fixing bsc#1200270 VUL-1: CVE-2022-1968: vim: use after free in utf_ptr2char * Fixing bsc#1200697 VUL-1: CVE-2022-2124: vim: out of bounds read in current_quote() * Fixing bsc#1200698 VUL-1: CVE-2022-2125: vim: out of bounds read in get_lisp_indent() * Fixing bsc#1200700 VUL-1: CVE-2022-2126: vim: out of bounds read in suggest_trie_walk() * Fixing bsc#1200701 VUL-1: CVE-2022-2129: vim: out of bounds write in vim_regsub_both() * Fixing bsc#1200732 VUL-1: CVE-2022-1720: vim: out of bounds read in grab_file_name() * Fixing bsc#1201132 VUL-1: CVE-2022-2264: vim: out of bounds read in inc() * Fixing bsc#1201133 VUL-1: CVE-2022-2284: vim: out of bounds read in utfc_ptr2len() * Fixing bsc#1201134 VUL-1: CVE-2022-2285: vim: negative size passed to memmove() due to integer overflow * Fixing bsc#1201135 VUL-1: CVE-2022-2286: vim: out of bounds read in ins_bytes() * Fixing bsc#1201136 VUL-1: CVE-2022-2287: vim: out of bounds read in suggest_trie_walk() * Fixing bsc#1201150 VUL-1: CVE-2022-2231: vim: null pointer dereference skipwhite() * Fixing bsc#1201151 VUL-1: CVE-2022-2210: vim: out of bounds read in ml_append_int() * Fixing bsc#1201152 VUL-1: CVE-2022-2208: vim: null pointer dereference in diff_check() * Fixing bsc#1201153 VUL-1: CVE-2022-2207: vim: out of bounds read in ins_bs() * Fixing bsc#1201154 VUL-1: CVE-2022-2257: vim: out of bounds read in msg_outtrans_special() * Fixing bsc#1201155 VUL-1: CVE-2022-2206: vim: out of bounds read in msg_outtrans_attr() * Fixing bsc#1201863 VUL-1: CVE-2022-2522: vim: out of bounds read via nested autocommand * Fixing bsc#1202046 VUL-1: CVE-2022-2571: vim: Heap-based Buffer Overflow related to ins_comp_get_next_word_or_line() * Fixing bsc#1202049 VUL-1: CVE-2022-2580: vim: Heap-based Buffer Overflow related to eval_string() * Fixing bsc#1202050 VUL-1: CVE-2022-2581: vim: Out-of-bounds Read related to cstrchr() * Fixing bsc#1202051 VUL-1: CVE-2022-2598: vim: Undefined Behavior for Input to API related to diff_mark_adjust_tp() and ex_diffgetput() * Fixing bsc#1202420 VUL-1: CVE-2022-2817: vim: Use After Free in f_assert_fails() * Fixing bsc#1202421 VUL-1: CVE-2022-2816: vim: Out-of-bounds Read in check_vim9_unlet() * Fixing bsc#1202511 VUL-1: CVE-2022-2862: vim: use-after-free in compile_nested_function() * Fixing bsc#1202512 VUL-1: CVE-2022-2849: vim: Invalid memory access related to mb_ptr2len() * Fixing bsc#1202515 VUL-1: CVE-2022-2845: vim: Buffer Over-read related to display_dollar() * Fixing bsc#1202599 VUL-1: CVE-2022-2889: vim: use-after-free in find_var_also_in_script() in evalvars.c * Fixing bsc#1202687 VUL-1: CVE-2022-2923: vim: NULL Pointer Dereference in GitHub repository vim/vim prior to 9.0.0240 * Fixing bsc#1202689 VUL-1: CVE-2022-2946: vim: use after free in function vim_vsnprintf_typval * Fixing bsc#1202862 VUL-1: CVE-2022-3016: vim: Use After Free in vim prior to 9.0.0285 Mon 12:00- Deleted patches: * restrict-shell-commands.patch * source-check-sandbox.patch * vim-8.0.1568-CVE-2021-3778.patch * vim-8.0.1568-CVE-2021-3796.patch * vim-8.0.1568-CVE-2021-3872.patch * vim-8.0.1568-CVE-2021-3927.patch * vim-8.0.1568-CVE-2021-3928.patch * vim-8.0.1568-CVE-2021-3984.patch * vim-8.0.1568-CVE-2021-4019.patch * vim-8.0.1568-CVE-2021-4193.patch * vim-8.0.1568-CVE-2021-46059.patch * vim-8.0.1568-CVE-2022-0319.patch * vim-8.0.1568-CVE-2022-0351.patch * vim-8.0.1568-CVE-2022-0361.patch * vim-8.0.1568-CVE-2022-0413.patch * vim-8.0.1568-globalvimrc.patch - Added patches: * vim-8.1.0297-dump3.patch * vim-8.2.2411-globalvimrc.patch * disable-unreliable-tests-arch.patch - Updated patches: * disable-unreliable-tests.patch * vim-7.3-filetype_changes.patch * vim-7.3-filetype_ftl.patch * vim-7.3-filetype_spec.patch * vim-7.3-gvimrc_fontset.patch * vim-7.3-help_tags.patch * vim-7.3-mktemp_tutor.patch * vim-7.3-name_vimrc.patch * vim-7.3-sh_is_bash.patch * vim-7.3-use_awk.patch * vim-7.4-disable_lang_no.patch * vim-7.4-filetype_apparmor.patch * vim-7.4-filetype_mine.patch * vim-7.4-highlight_fstab.patch * vim-8.0-ttytype-test.patch * vim-8.0.1568-defaults.patch * vim73-no-static-libpython.patch - Updated to version 8.2 with patch level 5038, fixes the following problems * Fixing bsc#1191770 VUL-0: CVE-2021-3875: vim: heap-based buffer overflow * Fixing bsc#1192167 VUL-0: CVE-2021-3903: vim: heap-based buffer overflow * Fixing bsc#1192902 VUL-0: CVE-2021-3968: vim: vim is vulnerable to Heap-based Buffer Overflow * Fixing bsc#1192903 VUL-0: CVE-2021-3973: vim: vim is vulnerable to Heap-based Buffer Overflow * Fixing bsc#1192904 VUL-0: CVE-2021-3974: vim: vim is vulnerable to Use After Free * Fixing bsc#1193466 VUL-1: CVE-2021-4069: vim: use-after-free in ex_open() in src/ex_docmd.c * Fixing bsc#1193905 VUL-0: CVE-2021-4136: vim: vim is vulnerable to Heap-based Buffer Overflow * Fixing bsc#1194093 VUL-1: CVE-2021-4166: vim: vim is vulnerable to Out-of-bounds Read * Fixing bsc#1194216 VUL-1: CVE-2021-4193: vim: vulnerable to Out-of-bounds Read * Fixing bsc#1194217 VUL-0: CVE-2021-4192: vim: vulnerable to Use After Free * Fixing bsc#1194872 VUL-0: CVE-2022-0261: vim: Heap-based Buffer Overflow in vim prior to 8.2. * Fixing bsc#1194885 VUL-0: CVE-2022-0213: vim: vim is vulnerable to Heap-based Buffer Overflow * Fixing bsc#1195004 VUL-0: CVE-2022-0318: vim: Heap-based Buffer Overflow in vim prior to 8.2. * Fixing bsc#1195203 VUL-0: CVE-2022-0359: vim: heap-based buffer overflow in init_ccline() in ex_getln.c * Fixing bsc#1195354 VUL-0: CVE-2022-0407: vim: Heap-based Buffer Overflow in Conda vim prior to 8.2. * Fixing bsc#1198596 VUL-0: CVE-2022-1381: vim: global heap buffer overflow in skip_range * Fixing bsc#1199331 VUL-0: CVE-2022-1616: vim: Use after free in append_command * Fixing bsc#1199333 VUL-0: CVE-2022-1619: vim: Heap-based Buffer Overflow in function cmdline_erase_chars * Fixing bsc#1199334 VUL-0: CVE-2022-1620: vim: NULL Pointer Dereference in function vim_regexec_string * Fixing bsc#1199747 VUL-0: CVE-2022-1796: vim: Use After in find_pattern_in_path * Fixing bsc#1200010 VUL-0: CVE-2022-1897: vim: Out-of-bounds Write in vim * Fixing bsc#1200011 VUL-0: CVE-2022-1898: vim: Use After Free in vim prior to 8.2 * Fixing bsc#1200012 VUL-0: CVE-2022-1927: vim: Buffer Over-read in vim prior to 8.2 * Fixing bsc#1070955 VUL-1: CVE-2017-17087: vim: Sets the group ownership of a .swp file to the editor's primary group, which allows local users to obtain sensitive information * Fixing bsc#1194388 VUL-1: CVE-2022-0128: vim: vim is vulnerable to Out-of-bounds Read * Fixing bsc#1195332 VUL-1: CVE-2022-0392: vim: Heap-based Buffer Overflow in vim prior to 8.2 * Fixing bsc#1196361 VUL-1: CVE-2022-0696: vim: NULL Pointer Dereference in vim prior to 8.2 * Fixing bsc#1198748 VUL-1: CVE-2022-1420: vim: Out-of-range Pointer Offset * Fixing bsc#1199651 VUL-1: CVE-2022-1735: vim: heap buffer overflow * Fixing bsc#1199655 VUL-1: CVE-2022-1733: vim: Heap-based Buffer Overflow in cindent.c * Fixing bsc#1199693 VUL-1: CVE-2022-1771: vim: stack exhaustion in vim prior to 8.2. * Fixing bsc#1199745 VUL-1: CVE-2022-1785: vim: Out-of-bounds Write * Fixing bsc#1199936 VUL-1: CVE-2022-1851: vim: out of bounds read- Minimal fix for Bug 1195004 - (CVE-2022-0318) VUL-0: CVE-2022-0318: vim: Heap-based Buffer Overflow in vim prior to 8.2. / vim-8.0.1568-CVE-2022-0413.patch - Fixing bsc#1190570 CVE-2021-3796: vim: use-after-free in nv_replace() in normal.c / vim-8.0.1568-CVE-2021-3796.patch - Fixing bsc#1191893 CVE-2021-3872: vim: heap-based buffer overflow in win_redr_status() drawscreen.c / vim-8.0.1568-CVE-2021-3872.patch - Fixing bsc#1192481 CVE-2021-3927: vim: vim is vulnerable to Heap-based Buffer Overflow / vim-8.0.1568-CVE-2021-3927.patch - Fixing bsc#1192478 CVE-2021-3928: vim: vim is vulnerable to Stack-based Buffer Overflow / vim-8.0.1568-CVE-2021-3928.patch - Fixing bsc#1193294 CVE-2021-4019: vim: vim is vulnerable to Heap-based Buffer Overflow / vim-8.0.1568-CVE-2021-4019.patch - Fixing bsc#1193298 CVE-2021-3984: vim: illegal memory access when C-indenting could lead to Heap Buffer Overflow / vim-8.0.1568-CVE-2021-3984.patch - Fixing bsc#1190533 CVE-2021-3778: vim: Heap-based Buffer Overflow in regexp_nfa.c / vim-8.0.1568-CVE-2021-3778.patch - Fixing bsc#1194216 CVE-2021-4193: vim: vulnerable to Out-of-bounds Read / vim-8.0.1568-CVE-2021-4193.patch - Fixing bsc#1194556 CVE-2021-46059: vim: A Pointer Dereference vulnerability exists in Vim 8.2.3883 via the vim_regexec_multi function at regexp.c, which causes a denial of service. / vim-8.0.1568-CVE-2021-46059.patch - Fixing bsc#1195066 CVE-2022-0319: vim: Out-of-bounds Read in vim/vim prior to 8.2. / vim-8.0.1568-CVE-2022-0319.patch - Fixing bsc#1195126 CVE-2022-0351: vim: uncontrolled recursion in eval7() / vim-8.0.1568-CVE-2022-0351.patch - Fixing bsc#1195202 CVE-2022-0361: vim: Heap-based Buffer Overflow in vim prior to 8.2. / vim-8.0.1568-CVE-2022-0361.patch - Fixing bsc#1195356 CVE-2022-0413: vim: use after free in src/ex_cmds.c / vim-8.0.1568-CVE-2022-0413.patch- install suse vimrc in /usr (boo#1182324, vim-8.0.1568-globalvimrc.patch)- source correct suse.vimrc file (boo#1182324)- stop owning /etc/vimrc so the old, distro provided config actually gets removed. Leaving it around leads to a duplicated autocmd for * .spec, leading to spec file template inserted twice. - own some dirs in vim-data-common so installation of vim-small doesn't leave not owned directories (boo#1173256). - Add vi as slave to update-alternatives so that every package has a matching "vi" symlink (bsc#1174564, boo#1176549).- Add restrict-shell-commands.patch to disable using interfaces in restricted mode, fixes bsc#1172225 CVE-2019-20807- introduce vim-small package with reduced requirements for small installations (boo#1166602). - BuildRequire pkg-config(krb5) instead of krb5-mini to be able to build against Tumbleweed repo.- Add source-check-sandbox.patch to fix CVE-2019-12735 boo#1137443- Pre-convert gvim icons, otherwise building vim depends on rsvg-convert -> librsvg -> cargo -> Rust -> LLVM - Cleanup SVG icon, make lines pixel-grid aligned - Correct RPM Group- Use %license instead of %doc [bsc#1082318]- instead of explicitly unsetting mouse, remove it from the defaults in the first place (boo#1079185, vim-8.0.1568-defaults.patch)- Switch to make -j1 clean to see if it fixes random build failures on Leap/SLE 15.- Updated to revision 1568, fixes the following problems * No test using a screen dump yet. * Screen dump test fails on MS-Windows. * Dead code found. * Assert_equalfile() does not close file descriptors. (Coverity) * Dump test fails when using a shadow directory. * Cannot use 24 bit colors in MS-Windows console. * Compiler warnings without termguicolors feature. * Libterm doesn't support requesting fg and bg color. * C syntax test fails when using gvim * C syntax test still fails when using gvim. * Quotestar test is flaky when using the GUI. * Xxd does not skip NUL lines when using ebcdic. * Popupmenu is too far left when completion is long. (Linwei) * No test for the popup menu positioning. * Popup menu positioning fails with longer string. * synpat_T is taking too much memory. * Terminal screen dump does not include cursor position. * With 'termguicolors' Normal color doesn't work correctly. * When using 'termguicolors' SpellBad doesn't show. * Screen dumps not included in distribution. * Using feedkeys() in a terminal window may trigger mappings. (Charles Sheridan) * Undo in the options window makes it empty. * Screen dump test script not included in distribution. * Various small problems in test files. * Various small problems in source files. * On Mac 'maxmemtot' is set to a weird value. * May leak file descriptors when executing job. * Cannot see what digraph is used to insert a character. * Custom plugins loaded with --clean. * Build error for some combination of features. * May not parse the t_RS response correctly, resulting in wrong characters in the input stream. * printf() does not work with only one argument. (Daniel Hahler) * No right-click menu in a terminal. * Build failure without GUI. * Build failure without GUI on MS-Windows. * Crash with rust syntax highligting. (Edd Barrett) * The terminal debugger can't set a breakpoint with the mouse. * Timeout of getwinposx() can be too short. (lilydjwg) * Too many #ifdefs. * Can't build Mac version without GUI. * Too many #ifdefs. * Cannot build Win32 GUI without IME. (John Marriott) * Can't build on older Mac, header file is missing.- Recommend vim-data so that colors can work by default- Updated to revision 1525, fixes the following problems * Compiler complains about uninitialized variable. (Tony Mechelynck) * Missing -D_FILE_OFFSET_BITS=64 may cause problems if a library is compiled with it. * Cannot act on edits in the command line. * Acessing freed memory after window command in auto command. (gy741) * Still too many old style tests. * Segmentation fault when Ruby throws an exception inside :rubyfile command. * Slow redrawing with DirectX. * Endless loop when gui_mch_stop_blink() is called while blink_state is BLINK_OFF. (zdohnal) * It is difficult to set the python home directory properly for Python 2.7 and 3.5 since both use $PYTHONHOME. * Terminal test fails on some systems. (jonathonf) * Terminal test fails on some slow terminals. * When in silent mode too much output is buffered. * If $SHELL contains a space then the default value of 'shell' is incorrect. (Matthew Horan) * Timer test on travis Mac is still flaky. * Clojure now supports a shebang line. * Filetype detection test does not check all scripts. * Cannot handle change of directory. * Missing file in patch. * Missing another file in patch. * Missing yet another file in patch. * Test fails without 'autochdir' option. * Completing directory after :find does not add slash. * Python2 and python3 detection not tested. (Matej Cepl) * Older GTK versions don't have gtk_entry_get_text_length(). * Libvterm doesn't handle illegal byte sequence correctly. * Illegal memory access in del_bytes(). * When package path is a symlink adding it to 'runtimepath' happens at the end. * Integer overflow when using regexp pattern. (geeknik) * On MS-Windows CursorIM highlighting no longer works. * MS-Windows: nsis installer is a bit slow. * MS-Windows: D&D fails between 32 and 64 bit apps. * Visual C 2017 has multiple MSVCVER numbers. * Invalid memory access in read_redo(). (gy741) * Screen isn't always updated right away. * Redraw flicker when moving the mouse outside of terminal window. * Unnecessary condition for "len" being zero. * Insert mode completion state is confusing. * Patch missing change. * Clearing a pointer takes two lines. * Using feedkeys() does not work to test Insert mode completion. (Lifepillar) * Searchpair() might return an invalid value on timeout. * Reduntant conditions. * Weird autocmd may cause arglist to be changed recursively. * Accessing invalid memory with "it". (Dominique Pelle) * Test 14 fails. * Emacs tags no longer work. (zdohnal) * There is no easy way to get the global directory, esp. if some windows have a local directory. * Number of spell regions is spread out through the code. * The minimum width of the popup menu is hard coded. * Memory leak in balloon_split(). * Completion items cannot be annotated. * No autocmd triggered in Insert mode with visible popup menu. * Having 'pumwidth' default to zero has no merit. * Clearing a pointer takes two lines. * Getting the jump list requires parsing the output of :jumps. * Getjumplist() returns duplicate entries. (lacygoill) * Out-of-memory situation not correctly handled. (Coverity) * Possible NULL pointer dereference. (Coverity) * Out-of-memory situation not correctly handled. (Coverity) * In out-of-memory situation character is not restored. (Coverity) * Access memory beyond end of string. (Coverity) * Win32: the screen may be cleared on startup. * Debugger can't break on a condition. (Charles Campbell) * New version of HP NonStop (Tandem) doesn't like the default header for setenv(). * Timer test is a bit flaky. * The :drop command is not always available. * Test for failing drag-n-drop command no longer fails. * Cannot test if a command causes a beep. * Some code for the debugger watch expression is clumsy. * Warning for possibly using NULL pointer. (Coverity) * The jumplist is not always properly cleaned up. * Getting the list of changes is not easy. * BufWinEnter event fired when opening hidden terminal. * Errors for job options are not very specific. * Invalid memory acces with pattern using look-behind match. (Dominique Pelle) * Error messages suppressed after ":silent! try". (Ben Reilly) * Getchangelist() does not use argument as bufname(). * Cursor is in the wrong line when using a WinBar in a Terminal window. * Shift-Tab does not work in a terminal window. * Popup menu is positioned in the wrong place. (Davit Samvelyan, Boris Staletic) * Cannot write and read terminal screendumps. * Compiler warnings for uninitialized variables. (Tony Mechelynck) * Using :wqa exits even if a job runs in a terminal window. (Jason Felice)- Split vim-data into vim-data-common package for low-disk usage scenarios bsc#1078722 bsc#1078554 bsc#1075541 - Make set mouse= default in suse.vimrc bsc#1079185 bsc#1078564 bsc#1067890 bsc#1064068 bsc#1062691- Updated to revision 1442, fixes the following problems * Crash when calling term_start() with empty argument. * Crash when term_start() fails. * MS-Windows: vimtutor fails if %TMP% has special chars. * After ":copen" can't get the window-ID of the quickfix window. (FalacerSelene) * Illegal memory access after undo. (Dominique Pelle) * GTK: :promtfind does not put focus on text input. (Adam Novak) * Memory leak in test_arabic. * Not enough information about what Python version may work. * Pkg-config doesn't work with cross compiling. * Filetype detection test not updated for change. * If cscope fails a search Vim may hang. * Terminal window: some vterm responses are delayed. * Using ":undo 0" leaves undo in wrong state. * Using pointer before it is set.- Make vim require vim-data bsc#1077352 bsc#1075541 bsc#1074790- Sort with spec-cleaner - Add conditional to build with python2 in order to build with py3 only enviroment - Convert dependencies to pkgconfig style- Updated to revision 1428, fixes the following problems * No test for expanding backticks. * Cursor column is not updated after ]s. (Gary Johnson) * Accessing freed memory in vimgrep. * Accessing invalid memory with overlong byte sequence. * No fallback to underline when undercurl is not set. (Ben Jackson) * Error in return not caught by try/catch. * The timer_pause test is flaky on Travis. * execute() does not work in completion of user command. (thinca) * "gf" and don't accept ? and & in URL. (Dmitrii Tcyganok) * The :leftabove modifier doesn't work for :copen. * Compiler warning on 64 bit MS-Windows system.- ignore make check transient errors for PowerPC bypass boo#1072651- Update apparmor.vim (taken from AppArmor 2.12) * add support for the "smc" network keyword- Updated to revision 1417, fixes the following problems * Encoding empty string to JSON sometimes gives "null". * Build fails with --with-features=huge --disable-channel. * Too much highlighting with 'hlsearch' and 'incsearch' set. * Cannot intercept a yank command. * It is not easy to see if a colorscheme is well written. * Memory leak when CTRL-G in search command line fails. * Pattern with \& following nothing gives an error. * :packadd does not load packages from the "start" directory. * Warnings and errors when building tiny version. (Tony Mechelynck) * Color scheme check script shows up as color scheme. * Cannot build with GTK but without XIM. (Guido) * Crash with nasty autocommand. (gy741, Dominique Pelle) * Using freed buffer in grep command. (gy741, Dominique Pelle) * Invalid memory access on exit when autocommands wipe out a buffer. * Duplicated code for getting a typed character. CursorHold is called too often in the GUI. (lilydjwg) * Difficult to track changes to a quickfix list. * GUI: CursorHold may trigger before 'updatetime' when using timers. * Crash in setqflist(). * Buffer overflow in :tags command. * Hang when using count() with an empty string. * Reading invalid memory with CTRL-W :. * Using free memory using setloclist(). (Dominique Pelle) * Accessing freed memory in :cbuffer. * Accessing freed memory in :lfile. * Warning for unused function without timers feature. * Crash when searching for a sentence. * Test doesn't search for a sentence. Still fails when searching for start of sentence. (Dominique Pelle)- Updated to revision 1390, fixes the following problems * Balloon shows when cursor is in WinBar. * terminal test hangs, executing abcde. (Stucki) * Cannot drag status line or vertical separator of new terminal window. (UncleBill) * MS-Windows: drawing underline, curl and strike-throw is slow, mFallbackDC not properly updated. * Channel test for callback is flaky. * Shift-Insert doesn't always work in MS-Windows console. * Profile log may be truncated halfway a character. * No error when settting 'renderoptions' to an invalid value before starting the GUI. * CTRL-A does not work with an empty line. (Alex) * Window size wrong after maximizing with WinBar. (Lifepillar) * Cursor in terminal not always updated. * Cannot call a dict function in autoloaded dict. * Autoload script sources itself when defining function. * Configure check for selinux does not check for header file. * When recovering a file with "vim -r swapfile" the hit-enter prompt is at the top of the window. * ch_readraw() waits for NL if channel mode is NL. * Get "no write since last change" message if a terminal is open. * Local additions in help skips some files. (joshklod) * Not enough quickfix help; confusing winid. * Python 3.5 is getting old. * Cannot select modified buffers with getbufinfo(). * Wordcount test is old style. * Char not overwritten with ambiguous width char, if the ambiguous char is single width but we reserve double-width space. * getqflist() items are missing if not set, that makes it more difficult to handle the values. * DirectX scrolling can be slow, vertical positioning is off.- Updated to revision 1365, fixes the following problems * Libvterm ANSI colors can not always be recognized from the RGB values. The default color is wrong when t_RB is empty. * The Terminal highlighting doesn't work in a terminal. * Some users don't want to diff with hidden buffers. * Terminal window colors wrong when using Terminal highlighting. * Recovering does not work when swap file ends in .stz. * There is no easy way to get the window position. * When one channel test fails others fail as well.- Update to revision 1358 * Too many changes to list - Fixes CVE-2017-1000382 bsc#1065958 - Refresh patches: * disable-unreliable-tests.patch * vim-7.3-filetype_spec.patch * vim-7.4-disable_lang_no.patch * vim-7.4-highlight_fstab.patch * vim-8.0-ttytype-test.patch- Explicitly require python2-devel- Add disable-unreliable-tests.patch to disable unreliable tests bsc#1054723- Bump priorities so we can upgrade from 12.3- Updated to revision 627, fixes the following problems * Call for requesting color and ambiwidth is too early. (Hirohito Higashi) * "1gd" may hang. * Bracketed paste is still enabled when executing a shell command. (Michael Smith) * Can't run make with several jobs, creating directories has a race condition. * The cursor line number becomes negative when using :z^ in an empty buffer. (neovim #6557) * Building the command table requires Perl. * Running parallel make after distclean fails. (Manuel Ortega) * Get only one quickfix list after :caddbuf. * Using freed memory when resetting 'indentexpr' while evaluating it. (Dominique Pelle) * Can't build when configure choses "install-sh". (Daniel Hahler) * Warning for uninitialized variable. (John Marriott) * :simalt on MS-Windows does not work properly. * Duplicate test case for quickfix. * Cannot set the valid flag with setqflist(). * Moving folded text is sometimes not correct. * Illegal memory access with z= command. (Dominique Pelle) * Fold test hangs on MS-Windows. * Memory leak when executing quickfix tests. * Test_options fails when run in the GUI. * No test for mapping timing out. * Configure check for return value of tgetent is skipped. * job_stop() often assumes the channel will be closed, while the job may not actually be stopped. (Martin Gammelsæter) * :simalt still does not work. * Cannot add a context to locations. * Changes to eval functionality not documented. * If a job writes to a buffer and the user is typing a command, the screen isn't updated. When a message is displayed the changed buffer may cause it to be cleared. (Ramel Eshed) * Duplication of code for adding a list or dict return value. * Build failure when windows feature is missing. * Coverity warning for not checking return value of dict_add(). * Crash when complete() is called after complete_add() in 'completefunc'. (Lifepillar) * Off-by-one error in buffer size computation. * Building with gcc 7.1 yields new warnings. * diff mode is insufficiently tested * test_recover fails on some systems. * No test coverage for :spellrepall. * When gF fails to edit the file the cursor still moves to the found line number. * gF test fails on MS-Windows. * gF test fails still on MS-Windows. * The buffer that quickfix caches for performance may become invalid. (Daniel Hahler) * Cannot set the context for a specified quickfix list. * When creating a bufref, then using :bwipe and :new it might get the same memory and bufref_valid() returns true. * Cannot manipulate other than the current quickfix list. * For some people the hint about quitting is not sufficient. * The screen is redrawn when t_BG is set and used to detect the value for 'background'. * When t_u7 is sent a few characters in the second screen line are overwritten and not redrawn later. (Rastislav Barlik) * Package directories are added to 'runtimepath' only after loading non-package plugins. * The conf filetype detection is done before ftdetect scripts from packages that are added later. * float2nr() is not exactly right. * Using % with :hardcopy wrongly escapes spaces. (Alexey Muranov) * When setting the cterm background with ":hi Normal" the value of 'background' may be set wrongly. * Hardcopy test hangs on MS-Windows. * NFA regex engine handles [0-z] incorrectly. * In the GUI, when a timer uses feedkeys(), it still waits for an event. (Raymond Ko) * Since we only support GTK versions that have it, the ckeck for HAVE_GTK_MULTIHEAD is no longer needed. * The ":stag" command does not respect 'switchbuf'. * Using a text object to select quoted text fails when 'selection' is set to "exclusive". (Guraga) * The message "Invalid range" is used for multiple errors. * Warning for unused variable in tiny build. (Tony Mechelynck) * shellescape() always escapes a newline, which does not work with some shells. (Harm te Hennepe) * In the GUI the cursor may flicker. * When 'wrapscan' is off "gn" does not select the whole pattern when it's the last one in the text. (KeyboardFire)- Extend vimrc with mappings for 8-bit controls key escape sequences- Conflict with old vim versions to fix the upgrade from 12.3 boo#1036583- Updated to revision 566, fixes the following problems * :windo allows for ! but it's not supported. * Undefined behavior when using backslash after empty line. * Not enough test coverage for syntax commands. * Crash when getting the window position in tmux. * Cannot detect Bazel BUILD files on some systems. * Using freed memory in :caddbuf after clearing quickfix list. * Setting nocompatible for the tiny version moves the cursor. - Refresh and re-add vim-8.0-ttytype-test.patch- Updated to revision 559, fixes the following problems * Test_edit causes older xfce4-terminal to close. (Dominique Pelle) * Cppcheck warnings. * Edit test may fail on some systems. * Swap file exists briefly when opening the command window. * Extra line break in verbosefile when using ":echomsg". (Ingo Karkat) * Saving the redo buffer only works one time, resulting in the "." command not working well for a function call inside another function call. * No test for the 8g8 command. * Some etags format tags file use 0x01, breaking the parsing. * The typeahead buffer is reallocated too often. * Toupper and tolower don't work properly for Turkish when 'casemap' is empty. (Bjorn Linse) * Toupper/tolower test with Turkish locale fails on Mac. * Toupper and tolower don't work properly for Turkish when 'casemap' contains "keepascii". (Bjorn Linse) * Toupper/tolower test fails on OSX without Darwin. * Getting the window position fails if both the GUI and term code is built in. * GTK: using static gravities is not useful. * The :ownsyntax command is not tested. * Setting ttytype to xxx does not always fail as expected. - Remove vim-8.0-ttytype-test.patch, fixed upstream.- Update the update-alternatives code- Updated to revision 542, fixes the following problems * ml_get errors in silent Ex mode. (Dominique Pelle) * A large count on a normal command causes trouble. (Dominique Pelle) * There is no way to remove quickfix lists (for testing). * Storing a zero byte from a multi-byte character causes fold text to show up wrong. * Character classes are not well tested. They can differ between platforms. * Using a function pointer instead of the actual function, which we know. * GtkForm handling is outdated. * MS-Windows: when 'clipboard' is "unnamed" yyp does not work in a :global command. * dv} deletes part of a multi-byte character. (Urtica Dioica) * Folds are messed up when 'encodin' is "utf-8". * Coverity complains about possible negative value. * RISC OS support was removed long ago, but one file is still included. * When 'wildmenu' is set and 'wildmode' has "longest" then the first file name is highlighted, even though the text shows the longest match. * Line in test commented out. * Buffer overflow when 'columns' is very big. (Nikolai Pavlov) * Test with long directory name fails on non-unix systems. * Test with long directory name fails on Mac. * Abbreviation doesn't work after backspacing newline. (Hkonrk) * Defaults.vim does not work well with tiny features. (crd477) * Memory leak when exiting from within a user function. * Quickfix window not updated when freeing quickfix stack. * Illegal memory access with :z and large count. * No test for falling back to default term value. * Startup test fails on Mac. * Building unit tests fails. * Compiler warning on MS-Windows. * getpos() can return a negative line number. (haya14busa)- Update spec.skeleton with spec-cleaner- Updated to revision 514, fixes the following problems * Insufficient testing for statusline. * 'makeencoding' missing from the options window. * Git and hg see new files after running tests. (Manuel Ortega) * Options test does not always test everything. * Options test fails or hangs on MS-Windows. * 'cinoptions' cannot set indent for extern block. * "make shadow" creates an invalid link. * Quite a few beeps when running tests. * Clang version not correctly detected. * Some functions are not tested. * Running the options test sometimes resizes the terminal. * The packadd test does not create the symlink correctly and does not test the right thing. * The fnamemodify test changes 'shell' in a way later tests may not be able to use system(). * Using ":%argdel" while the argument list is already empty gives an error. (Pavol Juhas) * Not enough test coverage in Insert mode. * Dead code in #ifdef. * Patch shell command uses double quotes around the argument, which allows for $HOME to be expanded. (Etienne) * Terminal width is set to 80 in test3. * Diffpatch fails when the file name has a quote. * Getpgid is not supported on all systems. * The ";" command does not work after characters with a lower byte that is NUL. * Getting font name does not work on X11. * Some macros are in lower case, which can be confusing. * Part of fold patch accidentally included. * v:progpath is not reliably set. * Some macros are in lower case. * Some macros are in lower case. * Adding fold marker creates new comment. * Compiler warnings for comparing unsigned char with 256 always being true. (Manuel Ortega) * The mode test may hang in Test_mode(). (Michael Soyka) * Typo in MinGW test makefile. * Using :move messes up manual folds. * Potential crash if adding list or dict to dict fails. * Old fix for :move messing up folding no longer needed, now that we have a proper solution. * Can't build on HPUX. * Test 45 hangs on MS-Windows. * If an MS-Windows tests succeeds at first and then fails in a way it does not produce a test.out file it looks like the test succeeded. * Resetting 'compatible' in defaults.vim has unexpected side effects. (David Fishburn) * Can't find executable name on Solaris and FreeBSD. * Off-by-one error in using :move with folding. * There are still a few macros that should be all-caps. * Using g< after :for does not show the right output. (Marcin Szamotulski) * After aborting an Ex command g< does not work. (Marcin Szamotulski) * Compiler warnings on MS-Windows. * Not enough testing for help commands. * Exit callback test sometimes fails. * When a test fails and test.log is created, Test_edit_CTRL_I matches it instead of test1.in. * No test covering arg_all(). * The client-server feature is not tested. * Not enough testing for the client-server feature. * Missing change to main.c. * The client-server test may hang when failing. * Tests use assert_true(0) and assert_false(1) to report errors. * remote_peek() is not tested. * The remote_peek() test fails on MS-Windows. * Unnecessary if statement. * The setbufvar() function may mess up the window layout. (Kay Z.) * Illegal memory access when using :all. (Dominique Pelle) * Using :lhelpgrep with an argument that should fail does not produce an error if the previous :helpgrep worked. * Not all windows commands are tested. * Crash and endless loop when closing windows in a SessionLoadPost autocommand. * The autocmd test hangs on MS-Windows. * Running tests leaves an "xxx" file behind. * Clipboard and "* register is not tested. * Splitting a 'winfixwidth' window vertically makes it one column smaller. (Dominique Pelle) * The quotestar test fails when a required feature is missing. * A failing client-server request can make Vim hang. * Crash with cd command with very long argument. * Build failure with older compiler on MS-Windows. * The quotestar test uses a timer instead of a timeout, thus it cannot be rerun like a flaky test. * Insufficient testing for folding. * Arabic support is not fully tested. * Two autocmd tests are skipped on MS-Windows. * taglist() does not prioritize tags for a buffer. * Quotestar test is still a bit flaky. * On MS-Windows ":!start" does not work as expected. * Coverity complains about possible NULL pointer. * Endless loop in updating folds with 32 bit ints. * Looking up an Ex command is a bit slow. * Failed window split for :stag not handled. (Coverity CID 99204) * Can't build with ANSI C. * Client-server tests fail when $DISPLAY is not set. * Coveralls no longer shows per-file coverage. * No link to codecov.io results. * Typo in link to codecov.io results. * Menuage for skipping client-server tests is unclear. * Check for available characters takes too long. * Getting name of cleared highlight group is wrong. (Matt Wozniski) * Script for creating cmdidxs can be improved.- Disable term=xxx test, does not work with any vim version * vim-8.0-ttytype-test.patch- Update apparmor.vim (taken from AppArmor 2.11) * add support for the "kcm" and "qipcrtr" network keywords * update change_profile rule highlighting- Build default vim without X11 support, use update-alternatives to prefer gvim if installed for X11 support.- Updated to revision 425, fixes the following problems * Packadd test does not clean up symlink. * Packadd test uses wrong directory name. * The E11 error message in the command line window is not translated. * The "zero count" error doesn't have a number. (Hirohito Higashi) * Xfontset and guifontwide are not tested. * Illegal memory access after "vapo". (Dominique Pelle) * Restoring help snapshot accesses freed memory. (Dominique Pelle) * GUI test fails on some systems. * Illegal memory access when 'complete' ends in a backslash. * Can't access b:changedtick from a dict reference. * Functions test fails. * Flags of :substitute not sufficiently tested. * Invalid memory access in :recover command. * :recover test fails on MS-Windows. * Illegal memory access with vi' * Not checking return valud of dict_add(). (Coverity) * When using complete() and typing a character undo is saved after the character was inserted. (Shougo) * Double free when compiled with EXITFREE and setting 'ttytype'. * b:changedtick can be unlocked, even though it has no effect. * Unlet command leaks memory. (Nikolai Pavlov) * islocked('d.changedtick') does not work. * Vim relies on limits.h to be included indirectly, but on Solaris 9 it may not be. (Ben Fritz) * When using CTRL-X CTRL-U inside a comment, the use of the comment leader may not work. (Klement) * When building with a shadow directory on macOS lacks the +clipboard feature. * Redrawing errors with GTK 3. * Not enough test coverage for Perl. * No test for concatenating an empty string that results from out of bounds indexing. * The condition for when a typval needs to be cleared is too complicated. * If [RO] in the status line is translated to a longer string, it is trunctted to 4 bytes. * Test to check that setting termcap key fails sometimes. * Using uninitialized memory when 'isfname' is empty. * Leaking memory when setting 'ttytype'. * Crash when setting 'guicursor' to weird value. * Invalid memory access in C-indent code. * 'number' and 'relativenumber' are not properly tested. * Sometimes VimL is used, which is confusing. * GUI initialisation is not sufficiently tested. * Tests fail on MS-Windows. * Travis is too slow to keep up with patches. * ]s does not move cursor with two spell errors in one line. * Might free a dict item that wasn't allocated. * Build fails with tiny features. * If configure defines _LARGE_FILES some include files are included before it is defined. * Not all options are tested with a range of values. * The 'balloondelay', 'ballooneval' and 'balloonexpr' options are not defined without the +balloon_eval feature. Testing that an option value fails does not work for unsupported options. * Invalid memory access when setting wildchar empty. * Leaking memory when setting v:completed_item. * More options are not always defined. * Build fails without +folding. * Invalid memory access when using :sc in Ex mode. (Dominique Pelle) * The "+ register is not tested. * Size computations in spell file reading are not exactly right. * Possible overflow when reading corrupted undo file. CVE-2017-6349 bsc#1027057 * Another possible overflow when reading corrupted undo file. CVE-2017-6350 bsc#1027053 * CTRL-Z and mouse click use CTRL-O unnecessary. * With 'linebreak' set and 'breakat' includes ">" a double-wide character results in "<<" displayed. * Diff mode is not sufficiently tested. * Warning in tiny build for unused variable. (Tony Mechelynck) * Misplaced #ifdef. (Christ van Willigen) * Timer test failed for no apparent reason. * No tests for arabic. * Tiny build has a problem with generating the options test. * compiler warnings * filtering lines through "cat", without changing the line count, changes manual folds. * Test for arabic does not check what is displayed. * When the window scrolls horizontally when the popup menu is displayed part of it may not be cleared. (Neovim issue #6184) * Arabic support is verbose and not well tested. * GUI test fails with Athena and Motif. * When the same tag appears more than once, the order is unpredictable. (Charles Campbell) * Tabs are not aligned when scrolling horizontally and a Tab doesn't fit. (Axel Bender) * Testing the + register fails with Motif. * 'balloonexpr' only works synchronously. * Cannot build with the viminfo feature but without the eval feature. * Illegal memory access with "t". * Crash when using balloon_show() when not supported. (Hirohito Higashi) * Some tests have a one second delay. * Test fails with missing balloon feature. * :map completion does not have . (Dominique Pelle) * GUI tests may fail. * Not enough testing for quickfix. * v:progpath may become invalid after ":cd". * The arabic shaping code is verbose. * Filtering folds with marker method not tested. * Updating folds does not work properly when inserting a file and a few other situations. * set_progpath is defined but not always used * Newer gettext/iconv library has extra dll file. * We can't change the case in menu entries, it breaks translations. * Menu test fails on MS-Windows. * Menu test fails on MS-Windows using gvim. * Balloon eval is not tested. * Balloon test fails on MS-Windows. * Setting v:progpath is not quite right. * Test for the clipboard fails sometimes. * ASAN logs are disabled and don't cause a failure. * Test for v:progpath fails on MS-Windows. * When running :make the output may be in the system encoding, different from 'encoding'. * Diff mode is displayed wrong when adding a line at the end of a buffer. * Python test fails with Python 3.6. * The effect of adding "#" to 'cinoptions' is not always removed. * Compiler warnings on MS-Windows. (Ajit Thakkar) * Build errors when building without folding. - Drop test87-python36.patch, fixed upstream.- Add test87-python36.patch to update test results for Python 3.6- Updated to revision 324, fixes the following problems * When a json message arrives in pieces, the start is dropped and the decoding fails. * Not enough testing for GUI functionality. * getcmdtype(), getcmdpos() and getcmdline() are not tested. * ":help :[range]" does not work. (Tony Mechelynck) * ":help z?" does not work. (Pavol Juhas) * No test for setting 'guifont'. * Small mistake in 7x13 font name. * Insert mode completion does not respect "start" in 'backspace'. * Warning for unused variable with small build. * When using the tiny version trying to load the matchit plugin gives an error. On MS-Windows some default mappings fail. * Possible overflow with spell file where the tree length is corrupted. CVE-2017-5953 bsc#1024724 * When running the command line tests there is a one second wait. * Illegal memory access with "1;y".- Updated to revision 311, fixes the following problems * Double free on exit when using a closure. (James McCoy) * Ex command range with repeated search does not work. (Bruce DeVisser) * When the GUI window is resized Vim does not always take over the new size. (Luchr) * Cannot stop diffing hidden buffers. (Daniel Hahler) * No tests for ":set completion" and various errors of the :set command. * Cannot set terminal key codes with :let. * Bracketed paste does not work in Visual mode. * Assign test fails in the GUI. * Invalid memory access when option has duplicate flag. * mode() not sufficiently tested. * Asan detects a memory error when EXITFREE is defined. (Dominique Pelle) * When using a symbolic link, the package path will not be inserted at the right position in 'runtimepath'. (Dugan Chen, Norio Takagi) * Cannot use an empty key in json. * Not enough testing for GUI functionality. * Linebreak tests are old style.- Updated to revision 296, fixes the following problems * Jumping to a tag that is a static item in the current file fails. (Kazunobu Kuriyama) * The test for :profile is slow and does not work on MS-Windows. * On MS-Windows the system() test skips a few parts. * Some syntax arguments take effect even after "if 0". (Taylor Venable) * Warning for an unused parameter when the libcall feature is disabled. Warning for a function type cast when compiling with -pedantic. * Some syntax arguments are not tested. * When completing a group name for a highlight or syntax command cleared groups are included. * No test for invalid syntax group name. * Order of complication flags is sometimes wrong. * Compiler warns for uninitialized variable. (Tony Mechelynck) * After :undojoin some commands don't work properly, such as :redo. (Matthew Malcomson) * Test coverage for :retab insufficient. * Leaking file descriptor when system() cannot find the buffer. (Coverity) * Internally used commands for CTRL-Z and mouse click end up in history. (Matthew Malcomson) * When using :substitute with the "c" flag and 'cursorbind' is set the cursor is not updated in other windows. * Vim does not support bracketed paste, as implemented by xterm and other terminals. * Build fails if the multi-byte feature is disabled. * The buffer used to store a key name theoreticaly could be too small. (Coverity) * The Netbeans "specialKeys" command does not check if the argument fits in the buffer. (Coverity) * Leaking memory when syntax cluster id is unknown. (Coverity) * When a Cscope line contains CTRL-L a NULL pointer may be used. (Coverity) * When decoding JSON with a JS style object the JSON test may use a NULL pointer. (Coverity) * Build fails without the cscope feature. * No command line completion for :cexpr, :cgetexpr, :caddexpr, etc. * Ubsan reports errors for integer overflow. * Completion for :match does not show "none" and other missing highlight names. * Checking if PROTO is defined inside a function has no effect. * When a multi-byte character ends in a zero byte, putting blockwise text puts it before the character instead of after it. * Coverity gets confused by the flags passed to find_tags() and warnts for an uninitialized variable. * When 'fileformats' is changed in a BufReadPre auto command, it does not take effect in readfile(). (Gary Johnson) * When a block is visually selected and put is used on the end of the selection only one line is changed. * The test for patch 8.0.0224 misses the CR characters and passes even without the fix. (Christian Brabandt) * Crash when 'fileformat' is forced to "dos" and the first line in the file is empty and does not have a CR character. * When pasting test in an xterm on the command line it is surrounded by and . (Johannes Kaltenbach) * When freeing a buffer the local value of the 'formatprg' option is not cleared. * When using bracketed paste line breaks are not respected. * There are no tests for bracketed paste mode. * Pasting in Insert mode does not work when bracketed paste is used and 'esckeys' is off. * The paste test fails if the GUI is being used. * When several lines are visually selected and one of them is short, using put may cause a crash. (Axel Bender) * Memory leak detected when running tests for diff mode. * Gcc complains that a variable may be used uninitialized. Confusion between variable and label name. (John Marriott) * When setting wildoptions=tagfile the completion context is not set correctly. (desjardins) * When using bracketed paste autoindent causes indent to be increased. * The address sanitizer sometimes finds errors, but it needs to be run manually. * The clang build on CI fails with one configuration. * Vim defines a mch_memmove() function but it doesn't work, thus is always unused. * Completion of user defined functions is not covered by tests. * When making a character lower case with tolower() changes the byte cound, it is not made lower case. * When the user sets t_BE empty after startup to disable bracketed paste, this has no direct effect. * The generated zh_CN.cp936.po message file is not encoded properly. * Compiler warnings for int to pointer conversion. * Under some circumstances, one needs to type Ctrl-N or Ctrl-P twice to have a menu entry selected. (Lifepillar) * vim_strcat() cannot handle overlapping arguments. * When two submits happen quick after each other, the tests for the first one may error out. * When virtcol() gets a column that is not the first byte of a multi-byte character the result is unpredictable. (Christian Ludwig) * It is not so easy to write a script that works with both Python 2 and Python 3, even when the Python code works with both. * Characters below 256 that are not one byte are not always recognized as word characters. * When creating a session when winminheight is 2 or larger and loading that session gives an error. * When using an assert function one can either specify a message or get a message about what failed, not both. * When calling setpos() with a buffer argument it often is ignored. (Matthew Malcomson) * Tests fail because some changes were not included. * The keyword test file is not included in the archive. * The keyword test file is not included in the archive. * Tab commands do not handle count correctly. (Ken Hamada) * Build fails with tiny features. * Not enough test coverage for eval functions. * Farsi support is barely tested. * Farsi support is not tested enough. * Memory error reported by ubsan, probably for using the string returned by execute(). * May get ml_get error when :pydo deletes lines or switches to another buffer. (Nikolai Pavlov, issue #1421) * Compiler warning for using uninitialized variable. * A channel test sometimes fails on Mac. * May get ml_get error when :luado deletes lines or switches to another buffer. (Nikolai Pavlov, issue #1421) * May get ml_get error when :perldo deletes lines or switches to another buffer. (Nikolai Pavlov, issue #1421) * May get ml_get error when :rubydo deletes lines or switches to another buffer. (Nikolai Pavlov, issue #1421) * May get ml_get error when :tcldo deletes lines or switches to another buffer. (Nikolai Pavlov, closes #1421) * Crash on exit is not detected when running tests. * Dead code detected by Coverity when not using gnome. * When update_single_line() is called recursively, or another screen update happens while it is busy, errors may occur. * When checking for CTRL-C typed the GUI may detect a screen resize and redraw the screen, causing trouble. * Checking for FEAT_GUI_GNOME inside GTK 3 code is unnecessary. * The GUI test may trigger fontconfig and take a long time. * GUI test fails on MS-Windows. * With MSVC 2015 the dll name is vcruntime140.dll. * On MS-Windows setting an environment variable with multi-byte strings does not work well. * MS-Windows files are still using ARGSUSED while most other files have UNUSED. * When doing a Visual selection and using "I" to go to insert mode, CTRL-O needs to be used twice to go to Normal mode. (Coacher) * The return value of mode() does not indicate that completion is active in Replace and Insert mode. (Zhen-Huan (Kenny) Hu) * The Test_collapse_buffers() test failed once, looks like it is flaky. * Tests fail with tiny build on Unix. * When concealing is active and the screen is resized in the GUI it is not immediately redrawn. * Cannot access the arguments of the current function in debug mode. (Luc Hermitte) * Errors reported while running tests. * No test for "ga" and :ascii. * If a wide character doesn't fit at the end of the screen line, and the line doesn't fit on the screen, then the cursor position may be wrong. (anliting) * Visual block insertion does not insert in all lines. * The stat test is a bit slow. * Some tests have a one or three second wait. * Argument list is not stored correctly in a session file. (lgpasquale) * test_viml hangs. * Bracketed paste can only append, not insert.- Improve summary bsc#1021040- Add missing %changelog to spec.skeleton- Updated to revision 194, fixes the following problems * When compiling with EBCDIC defined the build fails. (Yaroslav Kuzmin) * For completion "locale -a" is executed on MS-Windows, even though it most likely won't work. * Setting language in gvim on MS-Windows does not work when libintl.dll is dynamically linked with msvcrt.dll. * Using :change in between :function and :endfunction fails. * When opening a buffer on a directory and inside a try/catch then the BufEnter event is not triggered. * test_command_count may fail when a previous test interferes, seen on MS-Windows. * 'formatprg' is a global option but the value may depend on the type of buffer. (Sung Pae) * Error E937 is used both for duplicate key in JSON and for trying to delete a buffer that is in use. * When 'cursorbind' and 'cursorcolumn' are both on, the column highlignt in non-current windows is wrong. * When 'cursorbind' and 'cursorline' are set, but 'cursorcolumn' is not, then the cursor line highlighting is not updated. (Hirohito Higashi) * Ubsan warns for using a pointer that is not aligned. * When in Ex mode and an error is caught by try-catch, Vim still exits with a non-zero exit code. * The system() test fails on MS-Windows. * The error message from assert_notequal() is confusing. * Building with a new Ruby version fails. * Using NOT_VALID for redraw_later() to update the cursor line/column highlighting is not efficient. * There are no tests for the :profile command. * Detecting duplicate tags uses a slow linear search. * Some systems do not have ruby_sysinit(), causing the build to fail. * Build fails with tiny features. * Accidentally removed #ifdef. * Profile tests fails if total and self time are equal.- Updated to revision 172, fixes the following problems * When a C preprocessor statement has two line continuations the following line does not have the right indent. (Ken Takata) * ":earlier" and ":later" do not work after startup or reading the undo file. * When the pattern of :filter does not have a separator then completion of the command fails. * To pass buffer content to system() and systemlist() one has to first create a string or list. * Running the channel test creates channellog. * system() test fails on MS-Windows. * system() test fails on OS/X. * When sorting zero elements a NULL pointer is passed to qsort(), which ubsan warns for. * Several float functions are not covered by tests. * No command line completion for ":syntax spell" and ":syntax sync". * On MS-Windows some float functions return a different value when passed unusual values. strtod() doesn't work for "inf" and "nan". * Using a NULL pointer when using feedkeys() to trigger drawing a tabline. * EMSG() is sometimes used for internal errors. * Build fails when using small features. * Build error on Fedora 23 with small features and gnome2. * Ruby 2.4 no longer supports rb_cFixnum. * Outdated and misplaced comments. * Ubsan warns for integer overflow. * JSON with a duplicate key gives an internal error. (Lcd) * str2nr() and str2float() do not always work with negative values. * Still some float functionality is not covered by tests. * For complicated string json_decode() may run out of stack space. * Channel test fails for using freed memory. * JS style JSON does not support single quotes. * The command selected in the command line window is not executed. (Andrey Starodubtsev)- Updated to revision 147, fixes the following problems * Not enough test coverage for syntax commands. * Test fails because of using :finish. * "2;'(" causes ml_get errors in an empty buffer. * Null pointer access reported by UBsan. * An address relative to the current line, ":.,+3y", does not work properly on a closed fold. * When using indent folding and changing indent the wrong fold is opened. * When 'maxfuncdepth' is set above 200 the nesting is limited to 200. * Small build fails. * Warning for unused argument. * Pasting inserted text in Visual mode does not work properly. * Nested function test fails on AppVeyor. * Normal colors are wrong with 'termguicolors'. * Line number of current buffer in getbufinfo() is wrong. * When using MSVC the GvimExt directory is cleaned twice. * Running tests on MS-Windows is a little bit noisy. * When using 'termguicolors' on MS-Windows the RGB definition causes the colors to be wrong. * searchpair() does not work when 'magic' is off.- Updated to revision 130, fixes the following problems * Not enough testing for entering Ex commands. * Display problem with 'foldcolumn' and a wide character. (esiegerman) * Cancelling completion still inserts text when formatting is done for 'textwidth'. (lacygoill) * Display test fails on MS-Windows. * Parallel make still doesn't work. (Lewis Muir) * Configure uses "ushort" while the Vim code doesn't.- Updated to revision 124, fixes the following problems * May not process channel readahead. (skywind) * Value of 'thesaurus' option not checked properly. * When using ch_read() with zero timeout, can't tell the difference between reading an empty line and nothing available. * Cannot use a semicolon in 'backupext'. (Jeff) * When reading channel output in a timer, messages may go missing. (Skywind) * The channel "drop" option is not tested. * Still checking if memcmp() exists while every system should have it now. * Drop command doesn't use existing window. * The :history command is not tested. * Tests 92 and 93 are old style. * When reading English help and using CTRl-] the language from 'helplang' is used. * Parallel make fails. (J. Lewis Muir) * No test for using CTRL-R on the command line. * Setting 'cursorline' changes the curswant column. (Daniel Hahler) * Internal error for assert_inrange(1, 1).- Updated to revision 101, fixes the following problems * When the input or output is not a tty Vim appears to hang. * When a channel callback consumes a lot of time Vim becomes unresponsive. (skywind) * Can't build on MS-Windows. * Popup menu always appears above the cursor when it is in the lower half of the screen. (Matt Gardner) * Options that are a file name may contain non-filename characters. * Some options are not strictly checked. * (after 8.0.0101) cannot set 'dictionary' to a path- Updated to revision 95, fixes the following problems * Problems with GTK 3.22.2 fixed in 3.22.4.- Export "TERM=linux" before running the test suite: vim does quite an extensive test relying on a full fledged terminal inside OBS, stdio is redirected to a serial console (where the build log is being recorded/extracted. Systemd set non-local tty by default to vt220 in upcoming versions (which the vi test suite fails to run on; this should be considered a vim bug).- Updated to revision 92, fixes the following problems * Using NUL instead of NULL. * Crash when using the preview window from an unnamed buffer. (lifepillar) * On Windows job_stop() stops cmd.exe, not the processes it runs. (Linwei) * When a match ends in part of concealed text highlighting, it might mess up concealing by resetting prev_syntax_id. * An exiting job is detected with a large latency. * New code for job_stop() breaks channel test on AppVeyor. * Conceal test passes even without the bug fix. * No test for what 8.0.0047 fixes. * On Windows job_stop() stops cmd.exe, not the processes it runs. (Linwei) * Minor comment and style deficiencies. * When setting 'filetype' there is no check for a valid name. * Tests fail without the 'keymap' features. * Positioning of the popup menu is not good. * Vim does not build on VMS systems. * When using an Ex command for 'keywordprg' it is escaped as with a shell command. (Romain Lafourcade) * Compiler warning for unused variable. * No digraph for HORIZONTAL ELLIPSIS. * Compiler warning for comparing with unsigned. (Zoltan Arpadffy) * Normal test fails on MS-Windows. * Compiler warning for unused function in tiny build. (Tony Mechelynck) * when calling an operator function when 'linebreak' is set, it is internally reset before calling the operator function. * VMS has a problem with infinity. * Checking did_throw after executing autocommands is wrong. (Daniel Hahler) * Compiler warning for self-comparison. * Tests referred in Makefile that no longer exist. * Exit value from a shell command is wrong. (Hexchain Tong) * MS-Windows: Crash with long font name. (Henry Hu) * More comparisons between firstwin and lastwin. * Cannot make Vim fail on an internal error. * Using number for exception type lacks type checking. * Channel log has double parens ()(). * The GUI code is not tested by Travis. * Accessing freed memory in quickfix. * Accessing freed memory in quickfix. (Domenique Pelle) * The OS X build fails on Travis. * Inconsistent function names. * Extension for configure should be ".ac". * Using freed memory with win_getid(). (Domenique Pelle) * Using freed memory when adding to a quickfix list. (Domenique Pelle) * Using freed memory with recursive function call. (Dominique Pelle) * Cannot add a comment after ":hide". (Norio Takagi) * When the channel callback gets job info the job may already have been deleted. (lifepillar) * When a test fails in Setup or Teardown the problem is not reported. * Various problems with GTK 3.22.2. * Cursor moved after last character when using 'breakindent'. * Test_help_complete sometimes fails in MS-Windows console. * C indenting does not support nested namespaces that C++ 17 has. - Drop bsc-1008800.patch, fixed upstream.- Add bsc-1008800.patch to fix gvim rendering with recent gtk+ update. Fixes bsc#1008800. Patch by Jan Alexander Steffens.- Updated to revision 45, fixes the following problems * Cannot use overlapping positions with matchaddpos(). * No completion for ":messages". * Order of matches for 'omnifunc' is messed up. (Danny Su) * Detecting that a job has finished may take a while. * Get E924 when switching tabs. * OPEN_CHR_FILES not defined for FreeBSD using Debian userland files. * When Vim 8 reads an old viminfo and exits, the next time marks are not read from viminfo. (Ned Batchelder) * Whole line highlighting with matchaddpos() does not work. * When using Insert mode completion but not actually inserting anything an undo item is still created. (Tommy Allen) * When using Insert mode completion with 'completeopt' containing "noinsert" change is not saved for undo. (Tommy Allen) * When using Insert mode completion with 'completeopt' containing "noinsert" with CTRL-N the change is not saved for undo. (Tommy Allen) * In diff mode the cursor may end up below the last line, resulting in an ml_get error. * Calling job_stop() right after job_start() does not work.- Updated to revision 32, fixes the following problems * getwinvar() returns wrong Value of boolean and number options, especially non big endian systems. (James McCoy) * A string argument for function() that is not a function name results in an error message with NULL. (Christian Brabandt) * Netbeans test fails with Python 3. (Jonathonf) * ":lb" is interpreted as ":lbottom" while the documentation says it means ":lbuffer". * Vim 7.4 is still mentioned in a few places. * Popup complete test is disabled. * Unnecessary workaround for AppVeyor. * Crash when editing file that starts with crypt yeader. (igor2x) * On OSX Test_pipe_through_sort_all() sometimes fails. * Typos in comments. * Missing comma in list. * Crypt tests are old style. * Can't tell which part of a channel has "buffered" status. * Build fails. * Cannot get the number of the current quickfix or location list. * When using ":sleep" channel input is not handled. * Test_command_count is old style. * The regexp engines are not reentrant. * In the GUI when redrawing the cursor it may be on the second half of a double byte character. * If a channel in NL mode is missing the NL at the end the remaining characters are dropped. * "gd" and "gD" may find a match in a comment or string. * When the netbeans channel closes, "DETACH" is put in the output part. (Ozaki Kiichi) * Inconsistent use of spaces vs tabs in gd test. * Error format with %W, %C and %Z does not work. (Gerd Wachsmuth) * A channel is closed when reading on stderr or stdout fails, but there may still be something to read on another part. * Superfluous semicolons. * Code for MS-Windows is complicated because of the exceptions for old systems. * Mouse mode is not automatically detected for tmux. * After ":bwipeout" 'fileformat' is not set to the right default.- Updated to revision 3, fixes the following problems * getwinvar() returns wrong Value of boolean and number options, especially non big endian systems. (James McCoy)- Updated to revision 2, fixes the following problems * Intro screen still mentions version7. (Paul) * The netrw plugin does not work.- Update to version 8.0 * Crash on exit when EXITFREE is defined. (Dominique Pelle) * Valgrind reports using uninitialzed memory. (Dominique Pelle) * Test 86 and 87 fail with some version of Python. * Netbeans test fails when run from unpacked MS-Windows sources. * Netbeans test fails in shadow directory. * Not enough test coverage for Normal mode commands. * The example that explains nested backreferences does not work properly with the new regexp engine. (Harm te Hennepe) * Regexp fails to match when using "\>\)\?". (Ramel) * Reading past end of line when using previous substitute pattern. (Dominique Pelle) * Attempt to read history entry while not initialized. * Compiler warnings with Solaris Studio when using GTK3. * Memory leak in timer_start(). * Invalid memory access when formatting. (Dominique Pelle) * Checking for last_timer_id to overflow is not reliable. (Ozaki Kiichi) * Illegal memory access with ":1@". (Dominique Pelle) * Superfluous function prototypes. * Sort test sometimes fails. * Needless line break. Confusing directory name. * MS-Windows gvim.exe does not have DirectX support. * Test runner misses a comma.- Updated to revision 2347, fixes the following problems * submatch() does not check for a valid argument. * The 'langnoremap' option leads to double negatives. And it does not work for the last character of a mapping. * Can't use "." and "$" with ":tab". * With SGR mouse reporting (suckless terminal) the mouse release and scroll up/down is confused. * Warning for missing declaration of skip_vimgrep_pat(). (John Marriott) * Tests using the sleep time can be flaky. * Timer test sometimes fails. * Timer test sometimes fails. * Warning for assigning negative value to unsigned. (Danek Duvall) * Adding pattern to ":oldfiles" is not a generic solution. * Filter test fails. * Oldfiles test fails. * Tiny build fails. (Tony Mechelynck) * When cancelling the :ptjump prompt a preview window is opened for a following command. * Missing colon in error message. * Some error message cannot be translated. * In rare cases diffing 4 buffers is not enough. * Compiler warnings for signed/unsigned in expression. * Check for Windows 3.1 will always return false. (Christian Brabandt) * Compiler warnings in MzScheme code. * The script that checks translations can't handle plurals. * Coverity complains about null pointer check. * Coverity complains about not checking for NULL. * Two JSON messages are sent without a separator. * With 'incsearch' can only see the next match. * Channel test is flaky. * Build fails with small features. * Fail to read register content from viminfo if it is 438 characters long. (John Chen) * :filter does not work for many commands. Can only get matching messages. * When adding entries to an empty quickfix list the title is reset. * printf() isn't tested much. * printf() test fails on Windows. "-inf" is not used. * Build fails on MS-Windows. * Using CTRL-N and CTRL-P for incsearch shadows completion keys. * Using 'hlsearch' highlighting instead of matchpos if there is no search match. * Insufficient testing for NUL bytes on a raw channel. * Netbeans test doesn't read settings from file. * getbufinfo(), getwininfo() and gettabinfo() are inefficient. * getwininfo() and getbufinfo() are inefficient. * Command line completion on "find **/filename" drops sub-directory. * ":diffoff!" does not remove filler lines. * Command line test fails on Windows when run twice. * Memory leak in getbufinfo() when there is a sign. (Dominique Pelle) * New users have no idea of the 'scrolloff' option. * Starting diff mode with the cursor in the last line might end up only showing one closed fold. (John Beckett) * printf() doesn't handle infinity float values correctly. * Timer test fails sometimes. * When a child process is very fast waiting 10 msec for it is noticeable. (Ramel Eshed) * Part of ":oldfiles" command isn't cleared. (Lifepillar) * Comment in scope header file is outdated. (KillTheMule) * Generated files are outdated. * The tee program isn't included. Makefile contains build instructions that don't work. * The callback passed to ch_sendraw() is not used. * MS-Windows build instructions are clumsy. "dosbin" doesn't build. * When installing and $DESTDIR is set the icons probably won't be installed. * Compiler warning in tiny build. (Tony Mechelynck) * printf() handles floats wrong when there is a sign. * Not all systems understand %F in printf(). * Modelines in source code are inconsistent. * Sign test fails on MS-Windows when using the distributed zip archives. * Cscope test fails. * No tests for :undolist and "U" command. * When starting a job that reads from a buffer and reaching the end, the job hangs. * It is not possible to close the "in" part of a channel. * QuickFixCmdPre and QuickFixCmdPost autocommands are not always triggered. * Get warning for deleting autocommand group when the autocommand using the group is scheduled for deletion. (Pavol Juhas) * MS-Windows: some files remain after testing. * Default interface versions for MS-Windows are outdated. * When using "is" the mode isn't always updated. * In a timer callback the timer itself can't be found or stopped. (Thinca) * Marks, writefile and nested function tests are old style. * Default value for 'langremap' is wrong. * Several tests are old style. * Old charsearch test still listed in Makefile. * Crash when doing tabnext in a BufUnload autocmd. (Dominique Pelle) * Accessing freed memory when a timer does not repeat. * Appveyor 64 bit build still using Python 3.4 * Crash when autocommand moves to another tab. (Dominique Pelle) * Crash when deleting an augroup and listing an autocommand. (Dominique Pelle) * No error when deleting an augroup while it's the current one. * Insufficient testing for Normal mode commands. * Channel sort test is flaky. * Normal mode tests fail on MS-Windows. * When 'incsearch' is not set CTRL-T and CTRL-G are not inserted as before. * No way for a system wide vimrc to stop loading defaults.vim. (Christian Hesse) * Redraw problem when using 'incsearch'. * When a test is commented out we forget about it. * Access memory beyond the end of the line. (Dominique Pelle) * Using freed memory when using 'formatexpr'. (Dominique Pelle) * Crash when editing a new buffer and BufUnload autocommand wipes out the new buffer. (Norio Takagi) * Tiny build fails. * Illegal memory access when Visual selection starts in invalid position. (Dominique Pelle) * Freeing a variable that is on the stack. * Crash when BufWinLeave autocmd goes to another tab page. (Hirohito Higashi) * Error for min() and max() contains %s. (Nikolay Pavlov) * Coverity complains about not checking curwin to be NULL. * Using CTRL-X CTRL-V to complete a command line from Insert mode does not work after entering an expression on the command line. * Crash when stop_timer() is called in a callback of a callback. Vim hangs when the timer callback uses too much time. * Outdated comments in test. * On MS-Windows test_getcwd leaves Xtopdir behind. * taglist() is slow. (Luc Hermitte) * Running normal mode tests leave a couple of files behind. (Yegappan Lakshmanan) * taglist() is still slow. (Luc Hermitte) * Can't build with small features. (John Marriott) * Tab page test fails when run as fake root. * MS-Windows: Building with Ruby uses old version. * Tiny things. Test doesn't clean up properly. * Typo in MS-Windows build script. * Too many old style tests. * The "Reading from channel output..." message can be unwanted. Appending to a buffer leaves an empty first line behind. * For MinGW RUBY_API_VER_LONG isn't set correctly. Many default version numbers are outdated. * Autocommand test fails when run directly, passes when run as part of test_alot.- Updated to revision 2334, fixes the following problems * No tests for :undolist and "U" command. * When starting a job that reads from a buffer and reaching the end, the job hangs. * It is not possible to close the "in" part of a channel. * QuickFixCmdPre and QuickFixCmdPost autocommands are not always triggered. * Get warning for deleting autocommand group when the autocommand using the group is scheduled for deletion. (Pavol Juhas) * MS-Windows: some files remain after testing. * Default interface versions for MS-Windows are outdated. * When using "is" the mode isn't always updated. * In a timer callback the timer itself can't be found or stopped. (Thinca) * Marks, writefile and nested function tests are old style. * Default value for 'langremap' is wrong. * Several tests are old style. * Old charsearch test still listed in Makefile. * Crash when doing tabnext in a BufUnload autocmd. (Dominique Pelle) * Accessing freed memory when a timer does not repeat. * Appveyor 64 bit build still using Python 3.4 * Crash when autocommand moves to another tab. (Dominique Pelle) * Crash when deleting an augroup and listing an autocommand. (Dominique Pelle) * No error when deleting an augroup while it's the current one. * Insufficient testing for Normal mode commands. * Channel sort test is flaky. * Normal mode tests fail on MS-Windows. * When 'incsearch' is not set CTRL-T and CTRL-G are not inserted as before. * No way for a system wide vimrc to stop loading defaults.vim. (Christian Hesse) * Redraw problem when using 'incsearch'. * When a test is commented out we forget about it. * Access memory beyond the end of the line. (Dominique Pelle) * Using freed memory when using 'formatexpr'. (Dominique Pelle) * Crash when editing a new buffer and BufUnload autocommand wipes out the new buffer. (Norio Takagi) * Tiny build fails. * Illegal memory access when Visual selection starts in invalid position. (Dominique Pelle) * Freeing a variable that is on the stack. * Crash when BufWinLeave autocmd goes to another tab page. (Hirohito Higashi) * Error for min() and max() contains %s. (Nikolay Pavlov) * Coverity complains about not checking curwin to be NULL. * Using CTRL-X CTRL-V to complete a command line from Insert mode does not work after entering an expression on the command line. * Crash when stop_timer() is called in a callback of a callback. Vim hangs when the timer callback uses too much time. * Outdated comments in test. * On MS-Windows test_getcwd leaves Xtopdir behind.- Updated to revision 2295, fixes the following problems * The field names used by getbufinfo(), gettabinfo() and getwininfo() are not consistent. * Tab page tests are old style. * Test files have inconsistant modelines. * Startup test fails on Solaris. * There is no equivalent of 'smartcase' for a tag search. * ":oldfiles" output is a very long list. * The default ttimeoutlen is very long. * Crash when using funcref() with invalid name. (Dominique Pelle) * Can't build with +eval but without +quickfix. (John Marriott) * submatch() does not check for a valid argument. * The 'langnoremap' option leads to double negatives. And it does not work for the last character of a mapping. * Can't use "." and "$" with ":tab". * With SGR mouse reporting (suckless terminal) the mouse release and scroll up/down is confused. * Warning for missing declaration of skip_vimgrep_pat(). (John Marriott) * Tests using the sleep time can be flaky. * Timer test sometimes fails. * Timer test sometimes fails. * Warning for assigning negative value to unsigned. (Danek Duvall) * Adding pattern to ":oldfiles" is not a generic solution. * Filter test fails. * Oldfiles test fails. * Tiny build fails. (Tony Mechelynck) * When cancelling the :ptjump prompt a preview window is opened for a following command. * Missing colon in error message. * Some error message cannot be translated. * In rare cases diffing 4 buffers is not enough. * Compiler warnings for signed/unsigned in expression. * Check for Windows 3.1 will always return false. (Christian Brabandt) * Compiler warnings in MzScheme code. * The script that checks translations can't handle plurals. * Coverity complains about null pointer check. * Coverity complains about not checking for NULL. * Two JSON messages are sent without a separator. * With 'incsearch' can only see the next match. * Channel test is flaky. * Build fails with small features. * Fail to read register content from viminfo if it is 438 characters long. (John Chen) * :filter does not work for many commands. Can only get matching messages. * When adding entries to an empty quickfix list the title is reset. * printf() isn't tested much. * printf() test fails on Windows. "-inf" is not used. * Build fails on MS-Windows. * Using CTRL-N and CTRL-P for incsearch shadows completion keys. * Using 'hlsearch' highlighting instead of matchpos if there is no search match. * Insufficient testing for NUL bytes on a raw channel. * Netbeans test doesn't read settings from file. * getbufinfo(), getwininfo() and gettabinfo() are inefficient. * getwininfo() and getbufinfo() are inefficient. * Command line completion on "find **/filename" drops sub-directory. * ":diffoff!" does not remove filler lines. * Command line test fails on Windows when run twice. * Memory leak in getbufinfo() when there is a sign. (Dominique Pelle) * New users have no idea of the 'scrolloff' option. * Starting diff mode with the cursor in the last line might end up only showing one closed fold. (John Beckett) * printf() doesn't handle infinity float values correctly. * Timer test fails sometimes. * When a child process is very fast waiting 10 msec for it is noticeable. (Ramel Eshed) * Part of ":oldfiles" command isn't cleared. (Lifepillar) * Comment in scope header file is outdated. (KillTheMule) * Generated files are outdated. * The tee program isn't included. Makefile contains build instructions that don't work. * The callback passed to ch_sendraw() is not used. * MS-Windows build instructions are clumsy. "dosbin" doesn't build. * When installing and $DESTDIR is set the icons probably won't be installed. * Compiler warning in tiny build. (Tony Mechelynck) * printf() handles floats wrong when there is a sign. * Not all systems understand %F in printf(). * Modelines in source code are inconsistent. * Sign test fails on MS-Windows when using the distributed zip archives. * Cscope test fails.- Updated to revision 2225, fixes the following problems * When using matchaddpos() a character after the end of the line can be highlighted. * Can't build with +timers when +digraph is not included. * Recursive call to substitute gets stuck in sandbox. * printf() gives an error when the argument for %s is not a string. * printf() does not support binary format. * Sourcing a script where a character has 0x80 as a second byte does not work. * Buffer overflow when using latin1 character with feedkeys(). * Compiler warnings with older compiler and 64 bit numbers. * Crash when placing a sign in a deleted buffer.- Updated to revision 2216, fixes the following problems * The qf_init_ext() function is too big. * Compiler warning for initializing a struct. * There is still code and help for unsupported systems. * There is no way to get a list of the error lists. * When using ":vimgrep" may end up with duplicate buffers. * No proper testing of trunc_string(). * Coverage report is messed up by the unittests. * Can't run scripttests in the top directory. * Wrong part of #ifdef removed. * eval.c is too big. * Build fails. * eval.c is too big. * eval.c is too big. * Non-Unix builds fail. * Wrong file name. * qf_init_ext() is too big. * Using dummy variable to compute struct member offset. * eval.c is still too big. * Coverity warns for possible buffer overflow. * Compiler warns for uninitialzed variable. (John Marriott) * getcompletion() not well tested. * Compiler warning for char/char_u conversion. * Not all arguments of trunc_string() are tested. Memory access error when running the message tests. * spell.c is too big. * Missing change to include file. * The return value of type() is difficult to use. * substitute() does not support a Funcref argument. * rgb.txt is read for every color name. * One more place using a dummy variable. * No autocommand event to initialize a window or tab page. * Syntax error when dict has '>' key. * Cannot update 'tabline' when a tab was closed. * Running checks in po diretory fails. * Netbeans test fails on non-Unix systems. * When using PERROR() on some systems assert_fails() does not see the error. * Line numbers in the error list are not always adjusted. * Not much test coverage for digraphs. * Coverity complains about not restoring a value. * New digraph test makes testing hang. * Digraph tests fails on some systems. * Using the system default encoding makes tests unpredictable. * Digraph code test coverage is still low. * Keymap test fails with normal features. * Color handling of X11 GUIs is too complicated. * Using submatch() in a lambda passed to substitute() is verbose. * Coverity reports a resource leak when out of memory. * GTK 3 build fails with older GTK version. * Netbeans test fails once in a while. Leaving log file behind. * The color allocation in X11 is overly complicated. * Man test fails when run with the GUI. * Lambda functions show up with completion. * Warning from 64 bit compiler. * Text object tests are old style. * When a keymap is active only "(lang)" is displayed. * "cgn" and "dgn" do not work correctly with a single character match and the replacement includes the searched pattern. * Looping over windows, buffers and tab pages is inconsistant. * Tiny build with GUI fails. * Can't have "augroup END" right after ":au!". * Code duplication when unreferencing a function. * Configure reports default features to be "normal" while it is "huge". * Clang warns about missing field in initializer. * Misplaced equal sign. * Netbeans test is flaky. * Setting 'display' to "lastline" is a drastic change, while omitting it results in lots of "@" lines. * When there is an CmdUndefined autocmd then the error for a missing command is E464 instead of E492. (Manuel Ortega) * Defaults are very conservative. * getcompletion(.., 'dir') returns a match with trailing "*" when there are no matches. * Test for undo is flaky. * Tiny build fails. * Loading defaults.vim with -C argument. * The default vimrc for Windows is very conservative. * Deleting an augroup that still has autocmds does not give a warning. The next defined augroup takes its place. * Mac: can't build with tiny features. * Closures are not supported. * User defined functions can't be a closure. * No easy way to check if lambda and closure are supported. * Mac: don't get +clipboard in huge build. * No new style test for diff mode. * diffmode test leaves files behind, breaking another test. * Compiler warning for loss of data. * No tests for :diffget and :diffput * The short form of ":noswapfile" is ":noswap" instead of ":nos". * Memory leak when saving for undo fails. * Memory leak when using timer_start(). (Dominique Pelle) * Pending timers cause false memory leak reports. * More memory leaks when using partial, e.g. for "exit-cb". * test_partial has memory leaks reported. * Can't build with tiny features. * No error for using function() badly. * Various tiny issues. * Closure function fails. * Using function() with a name will find another function when it is redefined. * Test 86 and 87 fail. * :delfunction causes illegal memory access. * Tiny build fails. * Coverity reports bogus NULL check. * Leaking memory when redefining a function. * A funccal is garbage collected while it can still be used. * On MS-Windows quickix does not handle a line with 1023 bytes ending in CR-LF properly. * Win32: Using CreateThread/ExitThread is not safe. * Not enough testing for popup menu. CTRL-E does not always work properly. * test_alot fails. * Not much testing for cscope. * If a test leaves a window open a following test may fail. * Warning with MinGW 64. (John Marriott) * Quickfix test fails on MS-Windows. * No proper translation of messages with a count. * GUI test isn't testing much. * Test_communicate() fails sometimes. * Quotes make GUI test fail on MS-Windows. * Compiler warning. * Test_job_start_fails() is expected to report memory leaks, making it hard to see other leaks in test_partial. * Result of getcompletion('', 'cscope') depends on previous completion. * Insufficient testing for cscope. * setmatches() mixes up values. (Nikolai Pavlov) * Expression test fails without conceal feature. * Result of getcompletion('', 'sign') depends on previous completion. * match() and related functions tested with old style test. * It is not possible to use plugins in an "after" directory to tune the behavior of a package. * Startup test fails on MS-Windows. * Small build can't run startup test. * Small build can't run tests. * Not running the startup test on MS-Windows. * Startup test gets stuck on MS-Windows. * Cannot get information about timers. * MS-Windows build fails. * No test for "vim --help". * Can't test help on MS-Windows. * Adding duplicate flags to 'whichwrap' leaves commas behind. * Insufficient testing of cscope. * #ifdefs in main() are complicated. * No testing for -C and -N command line flags, file arguments, startuptime. * No test for reading from stdin. * Reading from stdin test fails on MS-Windows. * There is no easy way to stop all timers. There is no way to temporary pause a timer. * Compiler warning for unused variable. * Color Grey40 used in startup but not in the short list. * Sign tests are old style. * Tests that use RunVim() do not actually perform the test. * Test glob2regpat does not test much. * Timers test is flaky. * glob2regpat test fails on Windows. * Completion does not work properly with some plugins. * Cannot detect encoding in a fifo. * When startup test fails it's not easy to find out why. GUI test fails with Gnome. * No automatic prototype for vim_main2(). * Generating prototypes with Cygwin doesn't work well. * With Gnome when the GUI can't start test_startup hangs. * Sign tests don't cover enough. * MS-Windows: The vimrun program does not support Unicode. * glob2regpat test doesn't test everything on MS-Windows. * All functions are freed on exit, which may hide leaks. * Test alot sometimes fails under valgrind. (Dominique Pelle) * In the GUI the cursor is hidden when redrawing any window, causing flicker. * Cannot get all information about a quickfix list. * The sign column disappears when the last sign is deleted. * Build fails with small features. * Test fails with normal features. * It is not easy to get information about buffers, windows and tabpages. * 'wildignore' always applies to getcompletion(). * Warning for unused function. * The +xpm feature is not sorted properly in :version output. * Test for mappings is old style. * Cannot map . (Stephen Riehm) * On OSX configure mixes up a Python framework and the Unix layout. * Mouse support is not automatically enabled with simple term. * Mark " is not set when closing a window in another tab. (Guraga) * Cannot highlight the "~" lines at the end of a window differently. * A font that uses ligatures messes up the screen display. * It's not easy to find out if a window is a quickfix or location list window. * Test fails without the +sign feature.- Updated to revision 2045, fixes the following problems * Looking up a buffer by number is slow if there are many. * Netbeans file authentication not tested. * GTK: display updating is not done properly and can be slow. * setbufvar() causes a screen redraw. * filter() and map() either require a string or defining a function. * Memory leak when using a function callback.- Updated to revision 2033, fixes the following problems * Memory access error when reading viminfo. (Dominique Pelle) * "gd" hangs in some situations. (Eric Biggers) * Not all quickfix tests are also done with the location lists. * Background is not drawn properly when 'termguicolors' is set. * Coverity warns for unreachable code. * Win32: Cannot compile with XPM feature using VC2015 * The Man plugin doesn't work that well. * File list does not include new XPM libraries. * Viminfo continuation line with wrong length isn't skipped. (Marius Gedminas) * Using Ctrl-A with double-byte encoding may result in garbled text. * Minor problems with the quickfix code. * Quickfix long lines test not executed for buffer. * Ruby test is old style. * Cscope interface does not support finding assignments. * Not all parts of the quickfix code are tested. * No test for what 7.4.1948 fixes. * Using 32-bit Perl with 64-bit time_t causes memory corruption. (Christian Brabandt) * When using CTRL-W f and pressing "q" at the ATTENTION dialog the newly opened window is not closed. * Perl interface has obsolete workaround. * Perl interface preprocessor statements not nicely indented. * Crash when running test_channel.vim on Windows. * Unicode standard 9 was released. * When 'insertmode' is reset while doing completion the popup menu remains even though Vim is in Normal mode. * Two test files for increment/decrement. * Running Win32 Vim in mintty does not work. * The quickfix init function is too big. * When using a job in raw mode to append to a buffer garbage characters are added. * Coverity reports a resource leak. * Falling back from NFA to old regexp engine does not work properly. (fritzophrenic) * Invalid memory access with "\. * When the netbeans channel is closed consuming the buffer may cause a crash. * Using ":insert" in an empty buffer sets the jump mark. (Ingo Karkat) * It is not easy to see unrecognized error lines below the current error position. * On Solaris select() does not work as expected when there is typeahead. * GUI has a problem with some termcodes. * On MS-Windows large files (> 2Gbyte) cause problems. * Number variables are not 64 bits while they could be. * With 64 bit changes don't need three calls to sprintf(). * Large file test does not delete its output. * Getting value of binary option is wrong. (Kent Sibilev) * 'errorformat' is parsed for every call to ":caddexpr". Can't add to two location lists asynchronously. * No testing for Farsi code. * Viminfo file contains duplicate change marks. * farsi.c and arabic.c are included in a strange way. * Not all quickfix features are tested. * Missing changes in VMS build file. * Compiler warns for loss of data. * When copying unrecognized lines for viminfo, end up with useless continuation lines. * When updating viminfo with file marks there is no time order. * filter() and map() only accept a string argument. * Cscope items are not sorted. * glob() does not add a symbolic link when there are no wildcards. * Values for true and false can be confusing. * Not all TRUE and FALSE arguments are tested. * True-false test fails. * GUI: cursor drawn in wrong place if a timer callback causes a screen update. (David Samvelyan) * Capturing the output of a command takes a few commands. * Cannot easily scroll the quickfix window. * When writing buffer lines to a job there is no NL to NUL conversion. * evalcmd() doesn't work recursively. * Evalcmd test fails. * Tiny build fails. (Tony Mechelynck) * Crash when passing number to filter() or map(). * Still cursor flickering when a callback updates the screen. (David Samvelyan) * GUI: cursor displayed in the wrong position. * After using evalcmd() message output is in the wrong position. (Christian Brabandt) * Crash when using tabnext in BufUnload autocmd. (Norio Takagi) * Running the tests leaves a viminfo file behind. * evalcmd() has a confusing name. * Messages test fails. * There is a :cbottom command but no :lbottom command. * It is not easy to get a list of command arguments. * Test for getcompletion() does not pass on all systems. * Using "noinsert" in 'completeopt' breaks redo. * Using "noinsert" in 'completeopt' does not insert match. * When a file gets a name when writing it 'acd' is not effective. (Dan Church) * Warning from MinGW about _WIN32_WINNT redefined. (John Marriott) * When there are many errors adding them to the quickfix list takes a long time. * buf_valid() can be slow when there are many buffers. * When ignoring case utf_fold() may consume a lot of time. * Can't build without +autocmd feature. * Still too many buf_valid() calls. * Warnings from 64 bit compiler. * buflist_findname_stat() may find a dummy buffer. * More buf_valid() calls can be optimized. * The cursor blinking stops or is irregular when receiving date over a channel and writing it in a buffer, and when updating the status. * Reference counting for callbacks isn't right. * Can't build with +eval but without +menu. * cppcheck warns for using index before limits check. * printf() does not work with 64 bit numbers. * ARCH must be set properly when using MinGW. * The list_lbr_utf8 test fails if ~/.vim/syntax/c.vim sets 'textwidth' to a non-zero value. * Build fails with 64 bit MinGW. (Axel Bender) * 'cscopequickfix' option does not accept new value "a".- Updated to revision 1938, fixes the following problems * Updating marks in a quickfix list is very slow when the list is long. * When waiting for a character is interrupted by receiving channel data and the first character of a mapping was typed, the mapping times out. * When receiving channel data 'updatetime' is not respected. * Wrong computation of remaining wait time in RealWaitForChar() * When umask is set to 0177 Vim can't create temp files. * GUI: When channel data is received the cursor blinking is interrupted. * Channel reading very long lines is slow. * balloon eval only gets the window number, not the ID. * Cannot easily get the window ID for a buffer. * Cannot get the window ID for a mouse click. * Cannot use a window ID where a window number is expected. * Invoking mark_adjust() when adding a new line below the last line is pointless. * Various typos, long lines and style mistakes. * User commands don't support modifiers. * GTK 3: cursor blinking doesn't work well. * Using CTRL-] in the help on "{address}." doesn't work. * Win32: the "Disabled" menu items would appear enabled. * No test for collapsing buffers for a channel. Some text is lost. * When writing viminfo merging current history with history in viminfo may drop recent history entries. * Some compilers can't handle a double semicolon. * Collapsing channel buffers and searching for NL does not work properly. * Warnings from 64 bit compiler. * Netbeans uses uninitialzed pointer and freed memory. * Doubled semicolons. * Tests using external command to delete directory. * Recent history lines may be lost when exiting Vim. * No test for using setqflist() on an older quickfix list. * When ":doautocmd" is used modelines are used even when no autocommands were executed. * Executing autocommands while using the signal stack has a high chance of crashing Vim. * The effect of the PopupMenu autocommand isn't directly visible. * No proper test for what 7.4.1906 fixes. * History lines read from viminfo in different encoding than when writing are not converted. * Not enough testing for parsing viminfo lines. * Register contents is not merged when writing viminfo. * Missing test changes. * vim_time() not included when needed. * Ruby 2.4.0 unifies Fixnum and Bignum into Integer. * Command line editing is not tested much. * Missing "void" for functions without argument. * Viminfo does not merge file marks properly. * Possible crash with many history items. * Compiler warning for signed/unsigned. * Overwriting pointer argument. * Inconsistent indenting and weird name. * Can't build without +spell but with +quickfix. * Using both old and new style file mark lines from viminfo. * When writing viminfo the jumplist is not merged with the one in the viminfo file. * Compiler warning about uninitialzed variable. * New style tests not executed with MinGW compiler. * When using the GUI search/replace a second match right after the replacement is skipped. * Off-by-one error in bounds check. * No test for directory stack in quickfix. * When writing viminfo numbered marks were duplicated. - Refresh vim-7.3-filetype_spec.patch- Link to perl directly instead of dlopen'ing it.- vim must require %{?libperl_requires}, if perl is not updated with vim in lockstep, the following error occurs: vim: error while loading shared libraries: libperl.so and the program stops working. (boo#982869)- Updated to revision 1883, fixes the following problems * Python: encoding error with Python 2. * Memory leaks in test49. * Invalid memory access when exiting with EXITFREE defined. * Memory leak in test_matchstrpos. * Setting really_exiting causes memory leaks to be reported. * Appending to the quickfix list while the quickfix window is open is very slow. * When a callback adds a timer the GUI doesn't use it until later. * Comparing functions and partials doesn't work well. * Typing "k" at the hit-enter prompt has no effect. * Whether a job has exited isn't detected until a character is typed. After calling exit_cb the cursor is in the wrong place. * Channel test is flaky. * Appending to a long quickfix list is slow. * Check for line break at end of line wrong. * Cppcheck found 2 incorrect printf formats.- Updated to revision 1862, fixes the following problems * Using a partial for timer_start() may cause a crash. * Compiler warnings with 64 bit compiler. * string() with repeated argument does not give a result usable by eval().- Updated to revision 1859, fixes the following problems * Tests involving Python are flaky. * Ubsan detects a multiplication overflow. * Getting an item from a NULL dict crashes. * Can't build with Strawberry Perl 5.24 (obsoletes perl-5.24.patch) * Still trying to read from channel that is going to be closed. * GUI freezes when using a job. * test_syn_attr fails when using the GUI. * Unix: Cannot run all tests with the GUI. * Crash when job and channel are in the same dict while using partials. * When setting 'termguicolors' the Ignore highlighting doesn't work. * Valgrind reports memory leak for job that is not freed. * When a channel appends to a buffer that is 'nomodifiable' there is an error but appending is done anyway. * When a channel writes to a buffer it doesn't find a buffer by the short name but re-uses it anyway. * Cannot use a function reference for "exit_cb".- Update apparmor.vim (taken from AppArmor 2.10.1) * add support for the "unspec" network keyword- Updated to revision 1842, fixes the following problems * non-antialiased misnamed. * When timer_stop() is called with a string there is no proper error message. * Memory leak in debug commands. * Cannot use an Ex command for 'keywordprg'. * Possible crash when conceal is active. * When splitting and closing a window the status height changes. * When using a partial on a dictionary it always gets bound to that dictionary. * The BufUnload event is triggered twice, when :bunload is used with `bufhidden` set to `unload` or `delete`. * Functions specifically for testing do not sort together. * Cannot get the items stored in a partial. * When using packages an "after" directory cannot be used. * The code to reallocate the buffer used for quickfix is repeated. * get() works for Partial but not for Funcref.- Fix build with perl 5.24 (perl-5.24.patch)- Updated to revision 1829, fixes the following problems * No error when invoking a callback when it's not safe. * May try to access buffer that's already freed. * No message on channel log when buffer was freed.- Updated to revision 1826, fixes the following problems * The screen is not updated if a callback is invoked when closing a channel. * Help completion adds @en to all matches except the first one. * Compiler warnings when sprintf() is a macro. * Removing language from help tags too often. * Redirecting stdout of a channel to "null" doesn't work. * When a job is no longer referenced and does not have an exit callback the process may hang around in defunc state. * When job writes to buffer nothing is written. * Callbacks are invoked when it's not safe.- Updated to revision 1816, fixes the following problems * 'guicolors' is a confusing option name. * Quickfix doesn't handle long lines well, they are split. * GTK3 doesn't handle menu separaters properly. * Can't use Vim as MANPAGER. * Running tests in shadow dir fails. * 'termguicolors' option missing from the options window. * Test_out_close_cb sometimes fails. * Using wrong feature name to check for 'termguicolors'. * Using wrong short option name for 'termguicolors'. * Sending DETACH after a channel was closed isn't useful. * Netbeans channel gets garbage collected. * Memory access error when running test_quickfix. * A channel may be garbage collected while it's still being used by a job. * Looping over a null list throws an error. - Refresh vim-7.4-filetype_mine.patch- Updated to revision 1796, fixes the following problems * Cannot use ch_read() in the close callback. * Leading white space in a job command matters. * Channel could be garbage collected too early. * Color name decoding is implemented several times. * Some character classes may differ between systems.- Updated to revision 1786, fixes the following problems * When using the term truecolor feature, the t_8f and t_8b termcap options are not set by default. * Using negative index in strcharpart(). * Warnings reported by cppcheck. * synIDattr() does not respect 'guicolors'. * strcharpart() does not work properly with some multi-byte characters. * The old regexp engine doesn't handle character classes correctly. * Compiled-in colors do not match rgb.txt.- Updated to revision 1778, fixes the following problems * When using complete() it may set 'modified' even though nothing was inserted. * When using feedkeys() in a timer the inserted characters are not used right away. * Undo options are not together in the options window. * Arguments of setqflist() are not checked properly. * No "closed", "errors" and "encoding" attribute on Python output. * Cannot use true color in the terminal. * Newly added features can escape the sandbox. * When using the term truecolor feature, the t_8f and t_8b termcap options are not set by default.- Updated to revision 1754, fixes the following problems * When a buffer gets updated while in command line mode, the screen may be messed up. * Crash when 'tagstack' is off. (Dominique Pelle) * When adding to the quickfix list the current position is reset. * "noinsert" in 'completeopt' is sometimes ignored * syntax not set when using ":buf" and 'filetype' set manually- Updated to revision 1749, fixes the following problems * Cannot detect a crash in tests when caused by garbagecollect(). * The help for functions require a space after the "(". * The Perl interface cannot use 'print' operator for writing directly in standard IO. * It is not easy to get a character out of a string. * Python: turns partial into simple funcref. * Folds may close when using autocomplete. * Test fails when not using utf-8. * It is not possible to only see part of the message history. It is not possible to clear messages. * Count for ":messages" depends on number of lines. * syn-cchar defined with matchadd() does not appear if there are no other syntax definitions which matches buffer text. * Not testing utf-8 characters. * strgetchar() does not work correctly. * Clang warns for uninitialzed variable. (Michael Jarvis) * Python: Converting a sequence may leak memory. * Memory leak in Perl. * Coverity: missing check for NULL pointer. * "gD" does not find match in first column of first line. * When using GTK 3.20 there are a few warnings.- Updated to revision 1726, fixes the following problems * Crash when calling garbagecollect() after starting a job. * When using try/catch in 'tabline' it is still considered an error and the tabline will be disabled. * Tabline test fails in GUI. * Compiler errors for non-ANSI compilers. * ANSI compiler complains about string length.- Updated to revision 1721, fixes the following problems * Leaking memory when opening a channel fails. * Coverity: not using return value of set_ref_in_item(). * Leaking memory when there is a cycle involving a job and a partial. * Tests fail without the job feature.- Updated to revision 1716, fixes the following problems * When using try/catch in 'statusline' it is still considered an error and the status line will be disabled. * For plugins in packages, plugin authors need to take care of all dependencies. * GTK GUI doesn't work on Wayland. * Non-GUI specific settings in the gvimrc_example file. * Double free when a partial is in a cycle with a list or dict. * 'autochdir' doesn't work for the first file.- Updated to revision 1710, fixes the following problems * feedkeys('i', 'x') gets stuck, waits for a character to be typed. * Building the Perl interface gives compiler warnings. * ":syn reset" clears the effect ":syn iskeyword". (James McCoy) * When using :stopinsert in a silent mapping the "INSERT" message isn't cleared. * Display problems when the 'ambiwidth' and 'emoji' options are not set properly or the terminal doesn't behave as expected. * :packadd does not work the same when used early or late. * Using freed memory when parsing 'printoptions' fails. * Using freed memory with "wincmd p". (Dominique Pelle) * Cannot use empty dictionary key, even though it can be useful. * New regexp engine does not work properly with EBCDIC. * Not all output of an external command is read.- Updated to revision 1691, fixes the following problems * When reading JSON from a channel all readahead is used. * channel_get_all() does multiple allocations. * When writing buffer lines to a pipe Vim may block. * Completion doesn't work well for a variable containing "#". * When help exists in multiple languages, adding @ab while "ab" is the default help language is unnecessary. * The Dvorak support is a bit difficult to install. * The justify plugin has to be copied or sourced to be used. * The editexisting plugin has to be copied or sourced to be used. * The swapmous plugin has to be copied or sourced to be used. * The shellmenu plugin has to be copied or sourced to be used. * A reference to the removed file_select plugin remains. * Coverity: copying value of v_lock without initializing it. * Coverity warns for not checking name length (false positive). * Coverity warns for fixed size buffer length (false positive). * Coverity: no check for NULL. * README text is slightly outdated. * There is no easy way to get all the information about a match. * When running tests $HOME/.viminfo is written. * The channel close_cb option does not work. * MzScheme does not support partial. * Ruby interface has inconsistent coding style. * Can't compile with the conceal feature but without multi-byte. * When switching to a new buffer and an autocommand applies syntax highlighting an ml_get error may occur.- Updated to revision 1665, fixes the following problems * When 'F' is in 'shortmess' the prompt for the encryption key isn't displayed. * When binding a function to a dict the reference count is wrong. * Invoking garbage collection may cause a double free. * Crash when an autocommand changes a quickfix list. * Handling emoji characters as full width has problems with backwards compatibility. * Terminating file name has side effects. * Using string() on a partial that exists in the dictionary it binds results in an error. * When a dict contains a partial it can't be redefined as a function. * Using Python vim.bindeval() on a partial doesn't work. * Using freed memory after setqflist() and ":caddbuffer". * Compiler has a problem copying a string into di_key[]. * The matchit plugin needs to be copied to be used. * Quickfix test fails. * Old style test for fnamemodify(). * Users who loaded matchit.vim manually have to change their startup. * Crash when using expand('%:S') in a buffer without a name. * remote_expr() hangs. * Crash when using partial with a timer. * On Unix in a terminal: channel messages are not handled right away. * A plugin does not know when VimEnter autocommands were already triggered. * has('patch-7.4.1') doesn't work. * No test for special characters in channel eval command. * No test for an invalid Ex command on a channel. * Crash in :cgetexpr. * Crash when calling job_start() with a NULL string.- Updated to revision 1635, fixes the following problems * Quickfix code using memory after being freed. * Using channel timeout instead of request timeout. * Timers don't work on Unix. * Not checking for failed open(). * Memory leak when out of memory. * When starting the GUI fails a swap file is left behind. * Timer with an ":echo" command messes up display. * Although emoji characters are ambiguous width, best is to treat them as full width. * Catching exception that won't be thrown. * Having type() handle a Funcref that is or isn't a partial differently causes problems for existing scripts. * Comparing a function that exists on two dicts is not backwards compatible. * string() doesn't handle a partial. * Contents file is only for Amiga distro. * Compiler warnings for non-virtual destructor. * The versplit feature makes the code uneccessary complicated. * Can't build with small features. * Still can't build with small features. * Still quickfix test in old style. * Build fails with tiny features. * Malformed channel request causes a hang. * When a JSON message is split it isn't decoded. * Starting job with output to buffer changes options in the current buffer. * When 'fileformats' is set in the vimrc it applies to new buffers but not the initial buffer. * Emoji characters are not considered as a kind of word character. * Channel test doesn't work with Python 2.6. * Channel demo doesn't work with Python 2.6. * All Channels share the message ID, it keeps getting bigger. * Can't get info about a channel. * Trying to close file descriptor that isn't open. * Missing changes to structs. * Channel out_cb and err_cb are not tested. * 64-bit Compiler warning. * Handling emoji characters as full width has problems with backwards compatibility. * Unicode table for double width is outdated. * Compiler doesn't understand switch on all enum values. * List of test targets is outdated. * If the help tags file was removed "make install" fails. * Vertical movement after CTRL-A ends up in the wrong column. * Channel test is a bit flaky.- Updated to revision 1591, fixes the following problems * Crash when using function reference. * Using ":call dict.func()" where the function is a partial does not work. * Get E923 when using function(dict.func, [], dict). * Warning for unitinialized variable. * Partial is not recognized everywhere. * Nesting partials doesn't work. * Compiler warnings with 64 bit compiler. * Old style test for quickfix. * Combining dict and args with partial doesn't always work. * Warning for shadowed variable. * The quickfix title is truncated.- Updated to revision 1579, fixes the following problems * Passing cookie to a callback is clumsy. * Dict options with a dash are more difficult to use. * Missing update to proto file. * ":helptags ALL" crashes. * An empty list in function() causes an error. * Crash when assert_equal() runs into a NULL string. * Crash in assert_fails(). * Using CTRL-] in help on option in parentheses doesn't work. * Using old style tests for quickfix. * There is no way to avoid the message when editing a file. * No test for ":help". * Setting 'compatible' in test influences following tests. * Tests get stuck at the more prompt. * ":undo 0" does not work. * Write error of viminfo file is not handled properly. * Cannot pass "dict.Myfunc" around as a partial. * There is no way to invoke a function later or periodically.- Updated to revision 1558, fixes the following problems * Using "ever" for packages is confusing. * Specifying buffer number for channel not implemented yet. * MS-Windows job_start() closes wrong handle. * Compiler warning for unitinialized variable. * MS-Windows channel leaks file descriptor. * Using feedkeys() with an empty string disregards 'x' option. * Compiler warning for shadowed variable. * The feedkeys test has a one second delay. * Cannot re-use a channel for another job. * Too many feature flags for pipes, jobs and channels. * Selection with the mouse does not work in command line mode. * Too much code in eval.c. * Channel test is a bit flaky. * Missing job_info(). * job_start() with a list is not tested. * Channel log methods are not tested. * On Win32 escaping the command does not work properly. * GTK3: horizontal cursor movement in Visual selection not good. * Sticky type checking is more annoying than useful. * Getting a cterm highlight attribute that is not set results in the string "-1". * Two tests fail. * Cannot load packages early. * Cannot generate help tags in all doc directories. * ":colorscheme" does not use 'packpath'. * ":runtime" does not use 'packpath'. * Completion for :colorscheme does not use 'packpath'. * List of test targets incomplete. * "make install" changes the help tags file, causing it to differ from the repository. * Windows cannot be identified. * It is not easy to find out what windows display a buffer.- Switch back to GTK+2 because GTK+3 interface seems to be slower.- Updated to revision 1525, fixes the following problems * Statusline highlighting is sometimes wrong. * "J" fails if there are not enough lines. * Channel output to file not implemented yet. * Channel test is a bit flaky. * Channel with disconnected in/out/err is not supported. * Channel test: Waiting for a file to appear doesn't work. * Cannot write channel err to a buffer. * On a high resolution screen the toolbar icons are too small.- Updated to revision 1510, fixes the following problems * Crash when starting a job fails. * Keeping both a variable for a job and the channel it refers to is a hassle. * Channel test fails on AppVeyor.- Updated to revision 1506, fixes the following problems * No error message when :packadd does not find anything. * Garbage collection with an open channel is not tested. * Writing last-but-one line of buffer to a channel isn't implemented yet. * Crash when using ch_getjob(). * No test for reading last-but-one line. * When channel log is enabled get too many "looking for messages" log entries. * Job cannot read from a file.- Updated to revision 1498, fixes the following problems * ":loadplugin" is not optimal, some people find it confusing. * Not using key when result from hangul_string_convert() is NULL. * "inline" is not supported by old MSVC. * Compiler warning for unused function. * Visual-block shift breaks multi-byte characters. * No command line completion for ":packadd". * Wrong callback invoked for zero-id messages. * clr_history() does not work properly. * Crash when built with GUI but it's not active. * Cursor drawing problem with GTK 3. * Error for locked item when using json_decode().- Updated to revision 1485, fixes the following problems * When using hangulinput with utf-8 a CSI character is misintepreted. * Function arguments marked as unused while they are not. * Test_reltime is flaky, it depends on timing. * ":loadplugin" doesn't take care of ftdetect files. * No test for ":loadplugin". * Cannot add a pack direcory without loading a plugin. * "timeout" option not supported on ch_eval*(). * A one-time callback is not used for a raw channel. * Channel "err-io" value "out" is not supported. * Job input from buffer is not implemented.- Updated to revision 1474, fixes the following problems * Sort test doesn't test with "1" argument. * Channel test sometimes fails, especially on OS/X. * Coverity reports missing restore. * Missing out-of-memory check. And Coverity warning. * Can't build without the autocommand feature. * Compiler warnings without the float feature.- Updated to revision 1467, fixes the following problems * Error when reading fails uses wrong errno. Keeping channel open after job stops results in test failing. * The "out-io" option for jobs is not implemented yet. * When encoding JSON, turning NaN and Infinity into null without giving an error is not useful. * JSON encoding doesn't handle surrogate pair. * Can't get buffer number of a channel. * Using empty name instead of no name for channel buffer. * Memory corruption when 'encoding' is not utf-8. * Crash when using json_decode(). * Memory leak when using ch_read(). * JSON tests fail if 'encoding' is not utf-8. * Json encoding still fails when encoding is not utf-8. * Vim hangs when a channel has a callback but isn't referenced. * Test 87 fails with Python 3.5. * Opening a channel with select() is not done properly. * When a JSON channel has a callback it may never be cleared. * When the argument of sort() is zero or empty it fails.- Updated to revision 1421, fixes the following problems * When calling ch_close() the close callback is invoked, even though the docs say it isn't. * Using "u_char" intead of "char_u", which doesn't work everywhere. * Tests slowed down because of the "not a terminal" warning. * May free a channel when a callback may need to be invoked.- Disable sniff support, its unmaintained.- Updated to revision 1410, fixes the following problems * The close-cb option is not implemented yet. * Perl eval doesn't work properly on 64-bit big-endian machine. * Having 'autochdir' set during startup and using diff mode doesn't work. * GTK 3 is not supported. * Completion menu flickers. * Leaking memory in cs_print_tags_priv(). * json_encode() does not handle NaN and inf properly. * Leaking memory in cscope interface.- Updated to revision 1397, fixes the following problems * When the Job exit callback is invoked, the job may be freed too soon. * Starting a job hangs in the GUI. * Can't sort inside a sort function.- Drop vim-7.1.314-CVE-2009-0316-debian.patch, Python 2.7 has the appropriate fix.- Updated to revision 1385, fixes the following problems * Job and channel options parsing is scattered. * Channel test ch_sendexpr() times out. * Can't remove a callback with ch_setoptions(). * Channels don't have a queue for stderr. * X11 GUI callbacks don't specify the part of the channel. * Channel read implementation is incomplete. * Calling a Vim function over a channel requires turning the arguments into a string. * ch_setoptions() cannot set all options. * Can't change job settings after it started. * The job exit callback is not implemented. * Can't get the job of a channel. * It is not easy to use a set of plugins and their dependencies.- Updated to revision 1353, fixes the following problems * Compiler warnings in build with -O2. * When there is any error Vim will use a non-zero exit code. * When the test server fails to start Vim hangs. * When the port isn't opened yet when ch_open() is called it may fail instead of waiting for the specified time. * The test script lists all functions before executing them.- Updated to revision 1345, fixes the following problems * Crash when using channel that failed to open. * Crash when closing the channel in a callback. * Channel test fails on non-darwin builds. * Channel NL mode is not supported yet. * It's difficult to add more arguments to ch_sendraw() and ch_sendexpr(). * Can't compile with +job but without +channel.- Updated to revision 1328, fixes the following problems * Cursor changes column with up motion when the matchparen plugin saves and restores the cursor position. (Martin Kunev) * "\%1l^#.*" does not match on a line starting with "#". * Channel with pipes doesn't work in GUI. * Crash when unletting the variable that holds the channel in a callback function. * Can't compile with +job but without +channel.- Updated to revision 1294, fixes the following problems * copy() and deepcopy() fail with special variables. * Encoding {'key':} to JSON doesn't give an error. * assert_false(v:false) reports an error. * When jsonencode() fails it still returns something. * jsonencode() is not producing strict JSON. * Crash when evaluating the pattern of ":catch" causes an error. * The job feature isn't available on MS-Windows. * ch_open() with a timeout doesn't work correctly. * ch_sendexpr() does not use JS encoding. - Remove vim-7.3-diff_check.patch- Updated to revision 1194, fixes the following problems * New lines in the viminfo file are dropped. * Old style tests for the argument list. * Generated function prototypes still have __ARGS(). * Wrong argument to assert_exception() causes a crash. * Illegal memory access when using :copen and :cclose. * When running gvim in the foreground some icons are missing. * Recognizing does not work when the language is Turkish. * Using searchpair() with a skip expression that uses syntax highlighting sometimes doesn't work. * Cannot define keyword characters for a syntax file. * Can't sort on floating point numbers. * Default features are conservative. * Conflict for "chartab". * Using the local value of 'errorformat' causes more problems than it solves. * 'langmap' applies to the first character typed in Select mode. * Langmap test fails with normal build. * Autocommands triggered by quickfix cannot always get the current title value. * No support for JSON. * Build with normal features fails. * Coverity warns for NULL pointer and ignoring return value. * type() does not work for v:true, v:none, etc. * Automatically generated function prototypes use __ARGS. * No error for jsondecode('"'). * ":argadd" without argument is supposed to add the current buffer name to the arglist. * Missing error number in MzScheme. * Expressions "0 + v:true" and "'' . v:true" cause an error. * No tests for "is" and "isnot" with the new variables. * This doesn't give the right result: eval(string(v:true)). * No test for new behavior of v:true et al. * The +channel feature is not in :version output. * empty() doesn't work for the new special variables. * test_writefile and test_viml do not delete the tempfile. * Crash with invalid argument to glob2regpat(). * free_tv() can't handle special variables. * Error messages for security context are hard to translate. * The channel feature isn't working yet. * Can't build with FEAT_EVAL but without FEAT_MBYTE. * Compiler warning for not using return value of fwrite().- Updated to revision 1130, fixes the following problems * Repeating CTRL-A doesn't work. * No tests for :hardcopy and related options. * When making a change while need_wait_return is set there is a two second delay. * With 'rightleft' and concealing the cursor may move to the wrong position. * Vim can create a directory but not delete it. * When using ":next" with an illegal file name no error is reported. * Using {ns} in variable name does not work. (lilydjwg) * delete() does not work well with symbolic links. * delete(x, 'rf') does not delete files starting with a dot. * No longer get "." and ".." in directory list. * argidx() has a wrong value after ":%argdelete". (Yegappan Lakshmanan) * delete(x, 'rf') fails if a directory is empty. (Lcd) * Using ":argadd" when there are no arguments results in the second argument to be the current one. (Yegappan Lakshmanan) * There is no perleval(). * Can only get the directory of the current window. * Python None value can't be converted to a Vim value. * Memory leak in :vimgrep.- Updated to revision 1087, fixes the following problems * Wrong way to check for unletting internal variables. * The Tcl interface can't be loaded dynamically on Unix. * Crash when using an invalid command. * CTRL-A does not work well in right-left mode. * Using "." to repeat CTRL-A in Visual mode increments the wrong numbers. * The CTRL-A and CTRL-X commands do not update the '[ and '] marks. * Crash with an extremely long buffer name. * CTRL-A and CTRL-X work badly with blockwise visual selection- Updated to revision 1066, fixes the following problems * Segfault when unletting "count". * Illegal memory access with weird syntax command. (Dominique Pelle) * Typos in the :options window. * Compiler warning for ignoring return value of fwrite(). * When a spell file has single letter compounding creating suggestions takes an awful long time.- Updated to revision 1046, fixes the following problems * The fix in patch 7.3.192 is not tested. * When a symbolic link points to a file in the root directory, the swapfile is not correct. * Vim overwrites the value of $PYTHONHOME. * The local value of 'errorformat' is not used for ":lexpr" and ":cexpr". * The column is not restored properly when the matchparen plugin is used in Insert mode and the cursor is after the end of the line. * When there is a backslash in an option ":set -=" doesn't work. * An Ex range gets adjusted for folded lines even when the range is not using line numbers. * Using "q!" when there is a modified hidden buffer does not unload the current buffer, resulting in the need to abandon it again. * g-CTRL-G shows the word count, but there is no way to get the word count in a script.- Updated to revision 1004, fixes the following problems * searchpos() always starts searching in the first column, which is not what some people expect. (Brett Stahlman) * Leaking memory when hash_add() fails. Coverity error 99126.- Updated to revision 979, fixes the following problems * When pasting on the command line line breaks result in literal characters. This makes pasting a long file name difficult. * When using :diffsplit the cursor jumps to the first line. * Using ":sort" on a very big file sometimes causes text to be corrupted. (John Beckett) * test_cdo fails when using another language than English. * When changing the crypt key the blocks read from disk are not decrypted.- Updated to revision 972, fixes the following problems * Test 87 doesn't work in a shadow directory. * Configure doesn't work with a space in a path. * test86 and test87 are flaky in Appveyor. * Rare crash in getvcol(). (Timo Mihaljov) * The asin() function can't be used. * Memory leak when there is an error in setting an option.- Updated to revision 963, fixes the following problems * Crash when dragging with the mouse. * Segfault reading unitialized memory. * X11 and GTK have moure mouse buttons than Vim supports. * Memory leak when encountering a syntax error. * vt52 terminal codes are not correct. * There is no way to ignore case only for tag searches. * test_tagcase breaks for small builds. * Writing tests for Vim script is hard. * New style testing is incomplete. * Missing changes in source file. * Test_listchars fails with MingW. (Michael Soyka) * Can't build when the insert_expand feature is disabled. * When using 'colorcolumn' and there is a sign with a fullwidth character the highlighting is wrong. (Andrew Stewart) * v:errors is not initialized. * Sorting number strings does not work as expected. (Luc Hermitte) * 'lispwords' is tested in the old way. * When a test script navigates to another buffer the .res file is created with the wrong name. * When using Lua there may be a crash. (issue #468) * Vim doesn't recognize .pl6 and .pod6 files. * A few more file name extensions not recognized. * Test_tagcase fails when using another language than English. * Vim checks if the directory "$TMPDIR" exists. * When setting 'term' the clipboard ownership is lost. * Test107 fails in some circunstances. * Cannot run the tests with gvim. Cannot run individual new stests. * test_listlbr_utf8 sometimes fails.- Updated to revision 935, fixes the following problems * Test 94 fails on some systems. * test_utf8 has confusing dummy command. * Crash when using longest completion match.- Updated to revision 930, fixes the following problems * When a BufLeave autocommand changes folding in a way it syncs undo, undo can be corrupted. * Python interface can produce error "vim.message' object has no attribute 'isatty'". * Libraries for dynamically loading interfaces can only be defined at compile time. * Compiler complains about type punned pointer. * t_Ce and t_Cs are documented but not supported. (Hirohito Higashi) * Wrong indenting for C++ constructor. * No utf-8 support for the hangul input feature. * New compiler warning: logical-not-parentheses * When removing from 'path' and then adding, a comma may go missing. (Malcolm Rowe) * When running out of memory while copying a dict memory may be freed twice. (ZyX) * Compiler warning for comparing signed and unsigned. * A digit in an option name has problems. * The dll options are not in the options window. * The rubydll option is not in the options window. * Missing proto file update. (Randall W. Morris) * Leaking memory with ":helpt {dir-not-exists}". * Prototypes not always generated. * User may yank or put using the register being recorded in. * Completing the longest match doesn't work properly with multi-byte characters. * Ruby crashes when there is a runtime error. * A clientserver message interrupts handling keys of a mapping. * "gv" after paste selects one character less if 'selection' is "exclusive". * MS-Windows: Most users appear not to like the window border. - Refresh vim-7.3-sh_is_bash.patch- Updated to revision 898, fixes the following problems * Build failure when using dynamic python but not python3. * Indentation of array initializer is wrong. * On MS-Windows the iconv DLL may have a different name. * C indenting is wrong below a "case (foo):" * vimrun.exe is picky about the number of spaces before -s. * Custom command line completion does not work for a command containing digits. * Editing a URL, which netrw should handle, doesn't work. * Freeze and crash when there is a sleep in a remote command. (Karl Yngve Lervåg) * The 'fixendofline' option is set on with ":edit".- Updated to revision 889, fixes the following problems * Crash when changing the 'tags' option from a remote command. (Benjamin Fritz) * 'smarttab' is also effective when 'paste' is enabled. (Alexander Monakov) * May get into an invalid state when using getchar() in an expression mapping. * Vim leaks memory, when 'wildignore' filters out all matches. * Compiler warning for unused variable. (Tony Mechelynck) * Not obvious how to contribute. * ":find" sometimes fails. (Excanoe) * Coverity error for clearing only one byte of struct. * Can't see line numbers in nested function calls. * Test 49 fails. * When leaving the command line window with CTRL-C while a completion menu is displayed the menu isn't removed. * Block-mode replace works characterwise instead of blockwise after column 147. (Issue #422) * When doing an upwards search without wildcards the search fails if the initial directory doesn't exist. * Using uninitialized memory for regexp with back reference. (Dominique Pelle) * The OptionSet autocommands are not triggered from setwinvar(). * Triggering OptionSet from setwinvar() isn't tested.- Updated apparmor.vim (taken from AppArmor 2.10.0) * add support for the "ib" and "mpls" network keywords- Updated to revision 865, fixes the following problems * GTK: font glitches for combining characters * "zt" still doesn't work well with filler lines. (Gary Johnson) * Dragging the current tab with the mouse doesn't work properly. * It's a bit clumsy to execute a command on a list of matches. * Vim doesn't recognize all htmldjango files. * Filetype detection is outdated. * pango_shape_full() is not always available. * Still problems with pango_shape_full() not available. * plines_nofill() used without the diff feature.- Updated to revision 854, fixes the following problems * When '#' is in 'isident' the is# comparator doesn't work. * Compiler warning for possible loss of data. * "vi)d" may leave a character behind. * CTRL-A on hex number in Visual block mode is incorrect. * Moving the cursor in Insert mode starts new undo sequence. * does not show up. * Saving and restoring the console buffer does not work properly. * "zt" in diff mode does not always work properly. (Gary Johnson) * Missing information about runtime files.- Updated to revision 843, fixes the following problems * Xxd doesn't have a license notice. * The ruler shows "Bot" even when there are only filler lines missing. (Gary Johnson) * CTRL-A in Visual mode doesn't work properly with "alpha" in 'nrformat'. * After CTRL-V CTRL-A mode isn't updated. (Hirohito Higashi) * With a sequence of commands using buffers in diff mode E749 is given. (itchyny) * Invalid memory access when using "exe 'sc'". * Gcc sanitizer complains about using a NULL pointer to memmove(). * It is not possible to save and restore character search state. * Illegal memory access with "sy match a fold". * Invalid memory access when doing ":call g:". * Invalid memory access when doing ":fun X(". * Invalid memory access in file_pat_to_reg_pat(). * 'linebreak' breaks c% if the last Visual selection was block. (Chris Morganiser, Issue 389) * Invalid memory access in file_pat_to_reg_pat. * Cursor moves after CTRL-A on alphabetic character. * Invalid memory access for ":syn keyword x a[". * Crash when using "syn keyword x c". (Dominique Pelle) * Crash when clicking in beval balloon. (Travis Lebsock) * Resetting 'encoding' when doing ":set all&" causes problems. (Bjorn Linse) Display is not updated. * When expanding `=expr` on the command line and encountering an error, the command is executed anyway. * $HOME in `=$HOME . '/.vimrc'` is expanded too early. * More side effects of ":set all&" are missing. (Björn Linse) * gettabvar() doesn't work after Vim start. (Szymon Wrozynski) * Comparing utf-8 sequences does not handle different byte sizes correctly. * Can't compile without the crypt feature. (John Marriott) - Refresh vim-7.3-diff_check.patch- Updated to revision 803, fixes the following problems * Repeating a change in Visual mode does not work as expected. (Urtica Dioica) * Accessing memory before an allocated block. * Using freed memory when triggering CmdUndefined autocommands. * Test for ":diffoff" doesn't catch all potential problems. * Using "A" in Visual mode while 'linebreak' is set is not tested. * C indent does not support C11 raw strings. (Mark Lodato)- Updated to revision 797, fixes the following problems * Using freed memory and crash. (Dominique Pellej) * Test fails when the autochdir feature is not available. Test output contains the test script. * The buffer list can be very long. * Can only conceal text by defining syntax items. * Can't specify when not to ring the bell. * The 'fixeol' option is not copied to a new window. * Warning from 64 bit compiler. * Crash when using more lines for the command line than 'maxcombine'.- Updated to revision 788, fixes the following problems * CTRL-A and CTRL-X in Visual mode do not always work well. * :diffoff only works properly once. * Behavior of :diffoff is not tested. * Background color response with transparency is not ignored. * Search does not handle multi-byte character at the start position correctly. * 'langmap' is used in command-line mode when checking for mappings. Issue 376. * When using the CompleteDone autocommand event it's difficult to get to the completed items. * It is not possible to avoid using the first item of completion. * Equivalence class for 'd' does not work correctly. * Coverity warns for uninitialized variable. * Using CTRL-A in a line without a number moves the cursor. May cause a crash when at the start of the line. (Urtica Dioica) * Compiler complains about uninitialized variable and clobbered variables. * line2byte() returns one less when 'bin' and 'noeol' are set. * Still a few problems with CTRL-A and CTRL-X in Visual mode. * copy_chars() and copy_spaces() are inefficient. * Using both "noinsert" and "noselect" in 'completeopt' does not work properly. * On some systems automatically adding the missing EOL causes problems. Setting 'binary' has too many side effects. * It is not possible for a plugin to adjust to a changed setting. * snprintf() isn't available everywhere.- Updated to revision 763, fixes the following problems * Appending in Visual mode with 'linebreak' set does not work properly. Also when 'selection' is "exclusive". (Ingo Karkat) * Using CTRL-A in Visual mode does not work well. (Gary Johnson) * It is not easy to count the number of characters. * Cannot detect the background color of a terminal. * When 'conceallevel' is 1 and quitting the command-line window with CTRL-C the first character ':' is erased. * Spelling mistakes are not displayed after ":syn spell". * The request-background termcode implementation is incomplete. * Comment for may_req_bg_color() is wrong. (Christ van Willegen)- Updated to revision 752, fixes the following problems * When setting the crypt key and using a swap file, text may be encrypted twice or unencrypted text remains in the swap file. * The tab menu shows "Close tab" even when it doesn't work. * The cursor line is not always updated for the "O" command. * ml_get error when using "p" in a Visual selection in the last line. * Wrong argument for sizeof(). * In a string "\U" only takes 4 digits, while after CTRL-V U eight digits can be used. * ":1quit" works like ":.quit". (Bohr Shaw) * When using += with ":set" a trailing comma is not recognized. (Issue 365) * Cannot specify a vertical split when loading a buffer for a quickfix command. * "p" in Visual mode causes an unexpected line split. * No tests for Ruby and Perl. * The entries added by matchaddpos() are returned by getmatches() but can't be set with setmatches(). (Lcd) * ":[count]tag" is not always working. (cs86661) * ":cnext" may jump to the wrong column when setting 'virtualedit=all' * For some options two consecutive commas are OK. (Nikolay Pavlov) * It is not obvious how to enable the address sanitizer. * Unicode 8.0 not supported.- Make Perl support dynamic bsc#804070- Updated to revision 729, fixes the following problems * Illegal memory access when there are illegal bytes. * ":let list += list" can change a locked list. * Autocommands triggered by quickfix cannot get the current title value. * Overflow when adding MAXCOL to a pointer. * When 'list' is set Visual mode does not highlight anything in empty lines. (mgaleski) * 0x202f is not recognized as a non-breaking space character. * For indenting, finding the C++ baseclass can be slow. * ":call setreg('"', [])" reports an internal error. * Occasional crash with 'list' set.- Updated to revision 712, fixes the following problems * Out-of-bounds read, dectected by Coverity. * Not freeing memory when encountering an error. * The filename used for ":profile" must be given literally. * Various problems with locked and fixed lists and dictionaries. * E315 when trying to delete a fold. (Yutao Yuan) * Fold can't be opened after ":move". (Ein Brown) * Compiler warning for using uninitialized variable. (Yasuhiro Matsumoto) * Joining an empty list does uneccessary work. * Compiler warning for start_dir unused when building unittests. * Searching for a character matches an illegal byte and causes invalid memory access. (Dominique Pelle) * Can't build with Ruby 2.2. * Window drawn wrong when 'laststatus' is zero and there is a command-line window. (Yclept Nemo) * Undo files can have their executable bit set. * gettext() is called too often. * ":tabmove" does not work as documented. * It is not possible to make spaces visibible in list mode.- Updated to revision 694, fixes the following problems * When starting several Vim instances in diff mode, the temp files used may not be unique. (Issue 353) * When there are illegal utf-8 characters the old regexp engine may go past the end of a string. * "zr" and "zm" do not take a count. * There is no way to use a different in Replace mode for a terminal. * When "$" is in 'cpo' the popup menu isn't undrawn correctly. (Issue 166) * Memory access errors when changing indent in Ex mode. Also missing redraw when using CTRL-U. (Knil Ino) * Can't build with MzScheme. * Session file is not correct when there are multiple tab pages. * Running tests changes the .viminfo file.- Updated to revision 683, fixes the following problems * When using --remote the directory may end up being wrong. * CTRL-W in Insert mode does not work well for multi-byte characters. * MS-Windows: When Vim is minimized the window height is computed incorrectly. * The search highlighting and match highlighting replaces the cursorline highlighting, this doesn't look good. * Typo in the vimtutor command.- Updated to revision 676, fixes the following problems * When 'ruler' is set the preferred column is reset. (Issue 339) * Using freed memory when g:colors_name is changed in the colors script. (oni-link) * Using "0 CTRL-D" in Insert mode may have CursorHoldI interfere. (Gary Johnson) * When 'M' is in the 'cpo' option then selecting a text object in parenthesis does not work correctly. * When using netbeans a buffer is not found in another tab. * When 'compatible' is reset 'numberwidth' is set to 4, but the effect doesn't show until a change is made. * 'linebreak' does not work properly with multi-byte characters. * There is a chance that Vim may lock up. * 'colorcolumn' isn't drawn in a closed fold while 'cursorcolumn' is. (Carlos Pita) * Can't use a glob pattern as a regexp pattern. * When netbeans is active the sign column always shows up. * Using 'cindent' for Javascript is less than perfect. * Warning for shadowing a variable. * When completing a shell command, directories in the current directory are not listed. * The first syntax entry gets sequence number zero, which doesn't work. (Clinton McKay) * Missing changes in one file. * When a FileReadPost autocommand moves the cursor inside a line it gets moved back. - Refresh vim73-no-static-libpython.patch- Updated to revision 658, fixes the following problems * The tabline menu was using ":999tabnew" which is now invalid. * When using "gf" escaped spaces are not handled. * Stratus VOS doesn't have sync(). * When splitting the window in a BufAdd autocommand while still in the first, empty buffer the window count is wrong. * ":bufdo" may start at a deleted buffer. * Compiler complains about ignoring return value of fwrite(). (Michael Jarvis) * Configure check may fail because the dl library is not used. * Can't match "%>80v" properly for multi-byte characters. * Xxd lacks a few features. * Insert mode completion with complete() may have CTRL-L work like CTRL-P. * glob() and globpath() cannot include links to non-existing files. (Charles Campbell) * Text deleted by "dit" depends on indent of closing tag. (Jan Parthey) * Missing changes for glob() in one file. * Compiler warnings for pointer mismatch. * 'formatexpr' is evaluated too often.- Updated to revision 640, fixes the following problems * When using Insert mode completion combined with autocommands the redo command may not work. * The default conceal character is documented to be a space but it's initially a dash. (Christian Brabandt) * 7.4.592 breaks the netrw plugin, because the autocommands are skipped. * Marks are not restored after redo + undo. * If no NL or CR is found in the first block of a file then the 'fileformat' may be set to "mac". (Issue 77) * A search with end offset gets stuck at end of file. (Gary Johnson) * Incorrectly read the number of buffer for which an autocommand should be registered. * Can't build with Lua 5.3 on Windows. * Combination of linebreak and conceal doesn't work well. * After deleting characters in Insert mode such that lines are joined undo does not work properly. (issue 324)- Updated to revision 629, fixes the following problems * For complicated list and dict use the garbage collector can run out of stack space. * Syntax error. * The NFA engine does not implement the 'redrawtime' time limit. * Vim hangs when freeing a lot of objects. * Wrong ":argdo" range does not cause an error. * luaV_setref() is missing a return statement. (Ozaki Kiichi) * luaV_setref() not returning the correct value. * Compiler warning for unitinialized variable. (Tony Mechelynck) * Returning 1 in the wrong function. (Raymond Ko) * Compiler warning for unused argument. * Crash with pattern: \(\)\{80000} (Dominique Pelle) * May leak memory or crash when vim_realloc() returns NULL. * Possible NULL pointer dereference. * The last screen cell is not updated. * Compiler warning for variable might be clobbered by longjmp. * Coverity warning for Out-of-bounds read. - Remove vim-speedup-gc.patch, fixed upstream- Updated to revision 608, fixes the following problems * Compiler warnings for unitinialized variables. (John Little) * Can't match "%>80v" properly. (Axel Bender) * Range for :bdelete does not work. (Ronald Schild) * Parallel building of the documentation html files is not reliable. * Conceal does not work properly with 'linebreak'. (cs86661) * ":0argedit foo" puts the new argument in the second place instead of the first. * Using ctrl_x_mode as if it contains flags. * test_listlbr_utf8 fails when the conceal feature is not available. * When doing ":e foobar" when already editing "foobar" and 'buftype' is "nofile" the buffer is cleared. (Xavier de Gaye) * Crash when searching for "x\{0,90000}". (Dominique Pelle) * Using a block delete while 'breakindent' is set does not work properly. * The test_command_count test fails when using Japanese. * Tiny build doesn't compile. (Ike Devolder) * Cannot change the result of systemlist(). * Out-of-memory error. * Memory wasted in struct because of aligning. * It is not possible to have feedkeys() insert characters. * ":set" does not accept hex numbers as documented. * 'foldcolumn' may be set such that it fills the whole window, not leaving space for text. * Running tests changes viminfo. * The # register is not writable, it cannot be restored after jumping around. * May crash when using a small window. * Compiler warnings for unused variables.- Add vim-speedup-gc.patch to improve garbage collection performance. Based on https://github.com/neovim/neovim/pull/1761 (boo#899747)- Modify vim-7.3-filetype_changes.patch to expand tabs when editing * .changes files (bnc#900839)- Update suse.vimrc to stop remembering file positions for git commit cases. This fixes bnc#538369 and based on msys commits 1ef258e and 65ffc90.- Updated to revision 580, fixes the following problems * Ex range handling is wrong for buffer-local user commands. * Segfault with wide screen and error in 'rulerformat'. (Ingo Karkat) * No test for replacing on a tab in Virtual replace mode. * FEAT_OSFILETYPE is used even though it's never defined. * Ranges for arguments, buffers, tabs, etc. are not checked to be valid but limited to the maximum. This can cause the wrong thing to happen. * :argdo, :bufdo, :windo and :tabdo don't take a range. * Non-ascii vertical separater characters are always redrawn. * Giving an error for ":0wincmd w" is a problem for some plugins. * Having CTRL-C interrupt or not does not check the mode of the mapping. (Ingo Karkat) * Building with dynamic library does not work for Ruby 2.2.0 * Can't build with tiny features. (Ike Devolder) * Address type of :wincmd depends on the argument. * Mapping CTRL-C in Visual mode doesn't work. (Ingo Karkat) * No error for eval('$'). * Unicode character properties are outdated. * Redrawing problem with 'relativenumber' and 'linebreak'. * Matching with a virtual column has a lot of overhead on very long lines. (Issue 310) * Using getcurpos() after "$" in an empty line returns a negative number. * Wrong cursor positioning when 'linebreak' is set and lines wrap. * ":52wincmd v" still gives an invalid range error. (Charles Campbell)- Updated to revision 560, fixes the following problems * Tests fail with small features plus Python. * Crash when computing buffer count. Problem with range for user commands. Line range wrong in Visual area. * Cannot build with tiny and small features. (Taro Muraoka) * Crash when doing a range assign. * Using a range for window and buffer commands has a few problems. Cannot specify the type of range for a user command. * Since patch 7.4.232 "1,3s/\n//" joins two lines instead of three. (Eliseo Martínez) Issue 287 * Warnings for unused arguments when compiling with a combination of features. * Highlighting for multi-line matches is not correct. * Repeated use of vim_snprintf() with a number. * Using "vit" does not select a multi-byte character at the end correctly. * Function name not recognized correctly when inside a function. * curs_rows() function is always called with the second argument false. * "ygn" may yank too much. (Fritzophrenic) Issue 295. * Langmap applies to Insert mode expression mappings. * Various small issues. * Missing part of patch 7.4.519. * test_close_count may fail for some combination of features. * Failed commands in Python interface not handled correctly. * One more small issue. * When the X server restarts Vim may get stuck. * Appending a block in the middle of a tab does not work correctly when virtualedit is set. * Memory leak using :wviminfo. Issue 296.- use SUSE LINUX GmbH everywhere- Updated to revision 537, fixes the following problems * With a wrapping line the cursor may not end up in the right place. (Nazri Ramliy) * Using status line height in width computations. * Crash when using syntax highlighting. * Sun PCK locale is not recognzed. * When using "vep" a mark is moved to the next line. (Maxi Padulo, Issue 283) * Specifying wrong buffer size for GetLongPathName(). * When the X11 server is stopped and restarted, while Vim is kept in the background, copy/paste no longer works. (Issue 203) * When using ":ownsyntax" spell checking is messed up. (Issue 78) * map() leaks memory when there is an error in the expression. * matchstr() fails on long text. Daniel Hahler) * Still confusing regexp failure and NFA_TOO_EXPENSIVE. * Crash when using matchadd() (Yasuhiro Matsumoto) * No test for what 7.4.517 fixes. * Many commands take a count or range that is not using line numbers. * Comments about parsing an Ex command are wrong. * When using 'incsearch' "2/pattern/e" highlights the first match. * ":hardcopy" leaks memory in case of errors. * Warnings when compiling if_ruby.c. * Can't build with tiny features. * Test 63 fails when using a black&white terminal. * Value of v:hlsearch reflects an internal variable.- Updated to revision 516, fixes the following problems * When generating ja.sjis.po the header is not correctly adjusted. * Users are not aware their encryption is weak. * "-fwrapv" argument breaks use of cproto. * Generating proto for if_ruby.c uses type not defined elsewhere. * Crash because reference count is wrong for list returned by getreg(). * Memory access error. (Dominique Pelle) * In a help buffer the global 'foldmethod' is used. (Paul Marshall) * Completing a function name containing a # does not work. Issue 253.- Updated to revision 507, fixes the following problems * Setting the local value of 'backupcopy' empty gives an error. (Peter Mattern) * Compiler warning. * Crash when expanding a very long string. * CTRL-W } does not open preview window. (Erik Falor) * 'linebreak' does not work well together with Visual mode. * Issue 26: CTRL-C does not interrupt after it was mapped and then unmapped. * The "precedes" entry in 'listchar' will be drawn when 'showbreak is set and list is not. * Cursor movement is incorrect when there is a number column/sign/fold column and 'sbr' is displayed. * Can't compile on a system where Xutf8SetWMProperties() is not in the X11 library. Issue 265. * When using ":%diffput" and the other file is empty an extra empty line remains. * Using byte length instead of character length for 'showbreak'. * When 'balloonexpr' results in a list, the text has a trailing newline. (Lcd) * A 0x80 byte is not handled correctly in abbreviations. * Abbreviations don't work. (Toothpik) * Check for writing to a yank register is wrong. * ":sign jump" may use another window even though the file is already edited in the current window. * test_mapping fails for some people. * Cursor movement still wrong when 'lbr' is set and there is a number column. (Hirohito Higashi) * Cannot specify the buffer to use for "do" and "dp", making them useless for three-way diff. * When winrestview() has a negative "topline" value there are display errors. * In Insert mode, after inserting a newline that inserts a comment leader, CTRL-O moves to the right. (ZyX) Issue 57. * A TextChanged autocommand is triggered when saving a file. (William Gardner) * Cursor shape is wrong after a CompleteDone autocommand. * XPM isn't used correctly in the Cygwin Makefile. * With some regexp patterns the NFA engine uses many states and becomes very slow. To the user it looks like Vim freezes. * substitute() can be slow with long strings. * Test 72 still fails once in a while. * Typo in file pattern. * Language mapping also applies to mapped characters. * Cannot append a list of lines to a file.- Updated apparmor.vim (taken from AppArmor 2.9.0) * add support for 'hat' keyword * fix highlighting of comments in alias and link rules/bin/sh/bin/shgvim-basegvim-enhancedxxdh01-ch4a 1759907061  9.1.1629-150500.20.38.19.1.1629-150500.20.38.19.1.1629-150500.20.38.19.1.1629-150500.20.38.19.1.1629-150500.20.38.19.1.1629-150500.20.38.19.1.1629-150500.20.38.1 vivimgvimrcegviewegvimeviewevimgexgvigviewgvimgvimdiffrgviewrgvimvivimgvim.desktopgvimREADME.Japanese-XIMgui_x11.txtgvimrc_example.vimsuse.gvimrcgvim.pnggvim.pnggvim.pnggvim.pnggvim.pnggvim.pnggvim.pnggvim.pnggvim.svg/etc/alternatives//etc//usr/bin//usr/share/applications//usr/share/doc/packages//usr/share/doc/packages/gvim//usr/share/icons/hicolor/128x128/apps//usr/share/icons/hicolor/24x24/apps//usr/share/icons/hicolor/256x256/apps//usr/share/icons/hicolor/32x32/apps//usr/share/icons/hicolor/48x48/apps//usr/share/icons/hicolor/512x512/apps//usr/share/icons/hicolor/64x64/apps//usr/share/icons/hicolor/96x96/apps//usr/share/icons/hicolor/scalable/apps/-fmessage-length=0 -grecord-gcc-switches -O2 -Wall -D_FORTIFY_SOURCE=2 -fstack-protector-strong -funwind-tables -fasynchronous-unwind-tables -fstack-clash-protection -gobs://build.suse.de/SUSE:Maintenance:40859/SUSE_SLE-15-SP5_Update/41f148daee7fd87aa38ab6fe89d32022-vim.SUSE_SLE-15-SP5_Updatedrpmxz5x86_64-suse-linux cannot open `/home/abuild/rpmbuild/BUILDROOT/vim-9.1.1629-150500.20.38.1.x86_64/etc/alternatives/vi' (No such file or directory)cannot open `/home/abuild/rpmbuild/BUILDROOT/vim-9.1.1629-150500.20.38.1.x86_64/etc/alternatives/vim' (No such file or directory)ASCII textELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, interpreter /lib64/ld-linux-x86-64.so.2, for GNU/Linux 3.2.0, BuildID[sha1]=e206e2fa1ea76dc8ad5312bf7d1de4ee659fc274, strippeddirectoryPNG image data, 128 x 128, 8-bit/color RGBA, non-interlacedPNG image data, 24 x 24, 8-bit/color RGBA, non-interlacedPNG image data, 256 x 256, 8-bit/color RGBA, non-interlacedPNG image data, 32 x 32, 8-bit/color RGBA, non-interlacedPNG image data, 48 x 48, 8-bit/color RGBA, non-interlacedPNG image data, 512 x 512, 8-bit/color RGBA, non-interlacedPNG image data, 64 x 64, 8-bit/color RGBA, non-interlacedPNG image data, 96 x 96, 8-bit/color RGBA, non-interlacedSVG Scalable Vector Graphics image))R R)R'R"R!R RR RRRRRRRR+RRRR$R#RRRRRRRRRR,R R(R*RR RRR%R&R PPP P PP PPPPPPPPPP P j*$xɨutf-87586ad40cd44225e0005364f8b781dbc69e0e9d743b1bffde9ae2e41720f68b5?7zXZ !t/]"k%{J #20op60fҤjX%:aٹڽڭ#0"U ))@{P(J\;v) 3HdwA-U؅ T\L֥Dtr +ۭ4y<5>[EDp:(`#q?鳰=j=K}fI1| 45 ;E:Pn*h꠻_+YhfQhZ))O/ WyqV#S _Ɩ`"jFO =N:Ub!̥!3u'f|56r+ WS֧QTP6+c0xBt#ޥu3:(G~D̾5&.yK&֬bT%Ώ{lBb_VeFG|t,ӂ6>lh|6ynK+[Xcw;r̭NB)mtǟHaur6݁J"\#eko7D㬉w"\|Jر}Vĸrl䓁mdH|Nxi#{ˑTљϗQ߱; ˴q͠h, BLޛ4.B/U~G.߃V7)&h@3_N0UO$$.5R A/G|M;l}U@t.)0F[w\^ǀeAW$i䩇%33Ȩ ]erAGTc1D d3 th|72[c$a`CGzƠzښ.sn'ޟѦO%@C«ҤAg#DLti#0p>=\9mRH:,mw pMB/(ğ3r+ˁ\||,/.] Lla&ٚ ³ju.f`z8B~3P8HNJ،NPSeő=¿oVJϨ'v@2"sK׎XHؗBh a#mbB|dk*kr薉\Tr% } 6vF#quqMp$X>ܭ5B@~x=h㓪Txiajd FO/2ycl`hlȱlmg` 3CUB-?״9sf%(Mwᓻ4RHEg%GRLWJ5+ss%9W/DH^m]~"@9{tvU3s .eN؎XgR{;/|X\zYG1S:':PXH;1D6ԅ.J xB67~K^3էkah-#;' ]v~@ T;UGȚY[hxC}Wn-#U?j_oU<|+/gA8|.e$*Bؼ*J;a9oUruWkeÌ7h45pljѱ <[鍲O;ы@Ĉd`3(Q@#Tujq%B]Y^NDӑjml2UGŋ vƮ`cLZ$|weu=׳i`n+!jȲ0ư([~h|Ihːr.^6Ǖ#'vn6It%50E7S32Uy#(v=A#ȫHDl`"&/ۜ2!?/]Ϥ$PEq'_BT)Ф" ]R]=|Y0,ffqBa+`?}ΡP1~" QB49q_M_cGZW3|"JMS}7фEњC "+n3I> 8u4!@}-y)]--~A)B???b7soi:Q+zp3A5Ht5YA7GVkV1աP2`u5l ,ϐ2PRQCR1{ìl!WY譖P$`7#|uHSP H%Gijc-傠cG7,] źtĸ X 5B+O#4R: x@5 M rplS HàsՎ )م9?cqUIcE~"01De g/vDi"3ܑ~7 sI qμl |1vb7D:a$K"3xaWPoUM/]Vh_\ڼݮ2DB 6{<77qk%m#MWl/1tA HpocA.w89YEpre2mD,軞n4/z@YɣZO YX]X9ʻ65/s4n} z<(+uV T8ǻT9JbzmČkT +;>&l(uk+?dy_K<- 2bIp~9şDWIo=X*`cN^JTPUhQBq bgt哛x{|]N0k?]I`S%{4[`37cؚ[_-$|03uM?/oH:? L}H\~P sR)x0) ~ T mRku.<xTw8^7dN-TN$T 0 ~.Dø*𳜞ӗOꐗՐigql{ TjosQ'!>B ?8dS#{-|Ddyɂ`@+HzO2n㌛?P k1$,h lBլnl\0:rgr%R db`Vl8h8x/yiXTIf1+b#E؇shrӜ.^ܼ1|>GOb3{0Je_z(CZEYu;%Pe޵\̨&.V8Sb0r@'nLa{n:$J5=)ƪp?zsu^pig`~E@tلM?D<8"3͹rT5iBR|ӺvTѓ#柬BFtBQW"K" PK=z'W(Y0'aԩmc c̗|\_tc5tI#ԔC,M˳]]70ZߨWAcD9owsnGİ )6pX*D>FϛBJ;yY[jFHSͧ)jK6@r4fE%,9{E`~PuwUtED,~p,h$K 1yut24~A2AϱAv} ۟CkEZ`&O*\Vֆ׿ qx5m$3M=L.?]vaᢦsB\З~ПxMNr="# e26}~} Ʉe#J`4OܽƦÒ3'5XLvȒ.4%!$ߝUSy[OYϕʲl5z(~0+s7mЀEEps.).­Cx*Ϯ6HWoa3%Ò-ťQ~IҀ/:i Ƣj> ]\j (&/6,,z0ޚE|]v .ZK l<C-02z嗫c&Nնa|uS1x߾o[sxQ;.JL> qeq5*4XQ)#-6Iga?_NX)[dxhʲN^}9,B[~3{n \Cދ Ɋ,OTj3V"!`iB`hdl*krF/Sg-˃;}3>pmi°\8ҌE݇|DMm5DxfteeuwrxEk:ʒՑM{S,_b(3gD~!n4^4/" Z@:]R<6Uztwܬc' zVw~8<=C2ŽIuGu1ъU7'ⴷ 5S t[iqOÈwJ"rb ϛ3}Zo2몡TlWF?GSk$*FsaooC!u IaÑ&bXeOK8Z%ᗇ@p_y{ qh?9#-)2q ]@;ϣR齘GmD/^rK9.a-#Kg ]\Fb}ѦCpJT~ww_ou 0tSdh_E;gNZr1KEy$# \¤)4Epg1[%oFQDJ!U\㊦.nr?&Ѭe [hfxJˤ裘SWz.$ꢝ23@;h)__T7Ҳczcy'4 Z4nPSrjz|YFⴛ%>dY{y^">W=ylEEpXK+oLX'bQ%W!J(Md]+{p'ĹwZ1˶@IN3[͸'uiܽc=0~~1~¬O=D0K0&&².gmJ:/Dm rM`VvqܣY@- ؿ%=uJp0n~f=ʥL|l ?]hxV uj9V:S.(ҙa&Tռ2އ{PE JB _4a+onȧϬ y-ΫC"tJpے"j^.buפN3xI;RBKiٶfLzdVj,e$@\Ql櫀$<$ ZQȒd3^a vt4lft+A:b0ǢWZcͦ!БnGHzH>nV,2jW2=Ȩ -l>[ĈklKo$-H JϪ_wU39&\5?hHe<\%kr!PJeCAҗs>yڵ5/tU 0+7_?spXV Boϰy~i ݁ [@<\) s>3&x:#kU&5YkkGQU?H=+ɫ+&dvcr46ڋ:$9C rr~~o$Cnv9| y밭r 5+$ Fkq-A EH_<߿InH15nzFCRj#{IuĤ"ڝ Һݒ'%<(&K=m, XD8lK V;;:[~[d)gpq;/!AzLoJ-v1Sp(:1Oc7˜Xo)pa*7Puo&m3D},?` 3;782pa,_.08Dxd0kSb`MIxΊv`A4 + x|jLz 𴡒9=YT\ `!oA7xO›iؗ#? o/2(*n̓#jj[ ".2í,үi+U-4 K}RVj@w4LBr:۹Zo i0Aኪ!>~^Z ëv :O[8qPI5kh`Mpw)y1ԓٔ)<#TG٥/; -m3-{7}*;DL36v `~"P_fg:.m ?r"q8aK78@ شUƮc]8%aw'oJ T8"[zl@OMGs*;9H@IZ"M:n"LI5%7p;%LrzF&+(:Kj+gmGA9M.(֨WH!u@hch Kg>#ZX~}.!B3jTbt܄~8'gnvJRiqm;Jh>[(^_ypQ>]):#e^>P`@֯![kXMFDIX'ӿQ;.gIrt:,/d=撩|(67q~ B d`扤c0Ăty%XpsBS=D28*fan=r r]RV܊#ewf%S1~Ъđv"b.EU+jlY^&sE$DyՖbW0 oE7q"_~XHuo‹Hyӿ.owIB+y6vX)3W8C*(&Z>puzvb*@H,m=f gLıBf>g?H7s]YH\*u!"vEOR uּa<گ*xL'T7e&{CI{wqgz13d٦ܺ(`R%=_b#~N<ˉ~÷й [y%xm5n?kX^/}vҞѡt9%xLX}D4Npq0Zmv#bi˶7B $4 ܴ6_:r8k&2D}).Go"VV&ډC"b}{+V6̻܄}qr]/{1,'9C;' JrE) =48ȥ?iICc}"=E1t aļvu_xχQOMTpMMc\cK` AX=wJu_]gN[S#|9=sP/׷C&y5.^b05Wn{%³aĤ84Mڝ7Óښ' }w :JNDCf˫R2WXGfHk(NDJQDƅ"E3:)zlnT!.*W5;'3RB3$m#.pT'ѥZ]^IerCa^\Q$37ȹW 49J<q CJekaC0R z{DT?o^x PHM\U6fC4?uLWu ǛMgB挨-^4/CSљ *Hy^Z*3Brvlx IZȢKAFwNPړKف{猹%=O6H; 5IBjz7IĊ?mލ b h5]z_H:Ø~/Ãk ѧ6/0yOi7-P]sRa~|kڏ],)kA1奢k&4-[FӲH;+/2񬜞_)Pn=PrlbN|NYU%fcL$sHP:A;n֛yr=9_s6XCRz=I2(Z__)76퍕\avʓL=h؛*AaaL*5 $ܡ K9/=(j~py `n:Ѽ+ZVDBSxjֶ& Ow asdr Պ,*wt Dw+ ~p @CX_זxHW}c2&{M$Wd^ 1}Zy:}M[i W4r5i3Vm M[ٟR8H>}fq'XG.-sD=Eu1׭l V},9DnxCow;I3 t)kK&M^|v76֭M8E%–nGng:jejfq+"\= _?%6&aMwj?tb9Dti|Gg2z̢ UInI+YKx\aI+) 3LQKTKZD>b8usySp+۶%]eqw8+J-)IT3Sݧl:/A4jX~W[jN傊O@ l\ZOǍ(͓z? s ^%55 x0k7d_nӃEz/SM :dzrKMƓ p !\媯Jt{gֺqkT 1WW(;\_.fϻ>I0=}C z̘ld>N625@`5dIsD& ̯3񶖐ę̙8 &7-eSk <2FJמ1$jejF4&}c %cĚpZ_DYy{40fb0|7V>q<"B:^cV2?~,GN TfŌU|CYdj1)xyT-S@7/Mn5JX-3d=p$(z'BlRGfXl͊x4L4OR0@e207y#cd[1-i&"x(@v'ruiQU/- hduQ )wE ѥ%WdVnOwkvۛrkv?XX>tꁳe Kd(Ќ~cѤs sp$r"XSs~?/c #oFa)HA0'U?;+񑜈zߵ_-*x4urٕlj/BuxyuRY5P:Jm`yaVd;C h؃_x4$M/f2]G `b, 0hUX\VYkv fR75=IHƃ"M/ΝёР/h60fX,/ڑphr5mOGSD5X&l(/*kbPXQ K(ao錈U?neuTrAG;O tx}8>nE96BWkphgw\oH 6o|*χ`BjNmւ.6&{d Q2:JtK0hb}hM5Ntw"CwVE)~űa|]LxC_M,8p铴=&W Ū.$Ҏ/q'T)(#ErjU*\I+ 띰,f}P%_2^:R^G,/1a8q̳fg*.kXVP2hhmy߀Ni/Lt v`c{6(1,$!%q3LʴTUWTiJPD\ YF(d̵;D[0+FSz AʨP.k)AO?gl0<.Stƾ ok2bMD)K1¸%)la6AjM-/88Kg]S YvdIe..1kR2bl65} ֤XMro:v4;]1LK3KnV̺ i8ISwX2cwSI6w_o%. IK`*"Fqq#6`AtHO4|cۺ41UG9Wah[4adfFݐ(Ic< rd{:P?BM; "o 2ox x5z/d%CQ-%9d8U.c@<]5Udm/0'0_$i^oڑ' 4mU oQyșZu{Mt2^K,ҁumex$%, ,7k,yf mTN´_.nIo:~1Dqx&Qy 6(*aދࡏn(?&f4,ApkOJ}k9ÃAuM-Z-ؼ/GaeA 'Ф9A+ygghr-"uQ̐*19Ћo}1%%e7J$`:r^:" _=d-N#SwP6^Y wWͦEm-~v#scٮqSnױڍYhƦV8 $jV·iRBXo0~ah8լ& 10f%Tn "a|gԁV=#:DfvJu) dcBp1yw xO p>C d4/[[%gRvs'Drh7ղ[^[,NT_H!Q\p9@= 0 Tn$N1R.5b=E^l@p ^hf:n$ks^;߄uWKG1[(~ne$|o'\1p.tWre`/D#UGNͷFk=:8 8h tw~E;`VGV*66PMez&>>N]pęOS-Qﮩ#^Nj0{-ojHi"W{ pGvdΝ }DǢi6:v= C΢Y#;H=aZ{VGm6q5^\*'1˴1`.]Uu( 1W{.u@xor9I4G#+"T:}l@0][HQӜځkR^lKhrUTR^?Ř/ewbKt `1xE()@5K;0ӛZ@"d?=&Mr]Q቙nEùG5Ǵ{!P Pf?D)8r1묇LC<,7g?wR$guWѾdr16m2̌qNN=Ey |M_g]C pT%dlC#0n<AT~ . @>0D@51mDf\дN0|Dfh5M@fHa8a0`zP+1i+VϛU.&\^IS0IǢRx>/zм܊Tn4MÁ9ew Oŷio]:JQ{#X&ɣb ٗ [Ĥn-²-a 4x4U`L%R3*ߒ2~@vT!RUj/RSr4kJ8q4%R{UˮJ EorGSY ?~vxq[)hvt!h&Z2Gp T"q׺|h-8Պp?'iv;.pΨ@"!&[=w_ eBLz+>9' 4;?nb6!QT'y"o-ps ;GkTԃ ț%enKi bv7Ee(RX#֣-k"cA~uU+88JN$Ƿ74\03awts 1Rf`!A*K]}Mpé qV>h4Y%D8tQ+0;)Xc6-ʘ5ɀx Ra}_ e PeP|c~ңuOXV t:O 䔊# .{gVzd' B֐a)uA1v޺Ƽ). ʠ>\Pp7q(%ɤ)s!ޠ L |F Zaو J^aq ]365IUs 3?ov8=FB=q<}59>ֿpn mOƢ"SD>6@RHػσ;fp.@"7ad:6:4:DzT sEKUu[ާqϧWu,j4awk@ =a>H rE?3Gl@mQ ^ R=b,y9 |,[;uS-)YFCՏN쯸4]dHՐJJ|8~O`{w.JRe!5yrj&MRfh̶I!jEC$ AKap55ln0vz]#}ʹ,KCШXQnl9R8)6U"^~C">C;k Y `)r3<^uT0 $?q`m]} cP@qxY/ iV;<&GÌC-vE*b_l3w[*# F(S'Os, W7򮉠q$W)n)/QWreoPN} Fi-!"jlgM/6AT!g"lLL N2Wܐ\(oa[d@,YBQݖmdQ,듨3Lޘ&^FA#"QG@9[8qO[߇,r.-(u-[DGbU>ҲBՖE7'1dyJ-d"<)? +#8~3͏oYvH"/RIxb8j[Ym@tl$hXM6uAȵ$abAųHk7NI|7#Ъ. Ŧܳ{߇eYF dRklŒB扻"1&gPee>|oAй A-zeP hcy&+ G]mQ1*݁8yT&* A X.&5}"YbҼ3G\A UrVl'>>Vj}K\BEPԺu3vJNw:;׀:eLS[! C 9ˈvˌG))L9̷-pXfP#ZRZ:2Pa [q_m~BwK>k9qM?#.."LRF}p8!h X{?n>敃ZCыӹ-1v߸aYjvt,ϧ߶cߣHL'ExۦgL$YzC2dK1οֲź:#{zp2"x=8Mpru@"mXg 'bƮ$I=v<ulAΞ"OZ< `ĦFrY0C0hi2X&Wg{w #`#\ +"0iҒX(ˑ'68ݣB<^s3XInoGxum+h('=k;V/L+.Yjo3A[vd=[iܩF Kdq=  9oP_. fvN8O*)?GtNi8F&#e>DQ8"+_JQI?LTѿ N <7<_Paj, @ƒKJb4 qX4gɐtW Ȉf<; xZSꮭ{pVg RqwafBȡc\@4PzKie@GtNP@ 6UCd+cj/] @M{"pgb"D:Fd( Mzi"}<0 tظ adن [pD#Kܞf977HqFxJs{Z[*)d{,&F}Di5*!2Ѧˣ;xЄ`17"18+ezjavڵYt80T Q׵vc%iBQ Ow9` ,q8\o)Cv&p'OzO*bȎ!! ]㚊%tcYd}jJpmAj,j 9Ch b`HW" xO7 Mht% N 8{M嫹Nk_axBpgr:q[1WCir`/Y'<#WbG:g &)f{n9χ&Sr := ح)kF+|f]zנU^S%/vt<-||`$'!y*"/<%#ϗ22t*m%BFhdQsS>m27@2UD[5ŷJ'5,C}9 L-) m!^vYhbMy,@j]@="VۙŁ|C4nRY֙6F[S%\%3ϝ^GGn"kagi8owheH9Tg ز ?I&  P8jn=V4HA*ȂFn|c#hڟU5)NTsBz)bat2:񂕴|}P^GBΰO3ߍ2n,CHN @=yKq[M7{bnGK/<,DToӚWO. *Y"tU3}ZsJX/"gFeڲW&UZR{rq RUwXJ ova&1sSÂ-dpj]B.Nh=f#l?XxTs0_`u}ȡ pp޺1, 9dy -r!lB #xZ9AvOϔ;QC R3MJ%rnXmEuY܍ZH޷N VIudIN{VWpN {JG8g^'b}ωLuDwz~#}I ytߎ + PT%-Rs q, {0k K8v''SWK 5 v{72IUMUjoAK6MYh1ǽSp$oɌW/)N8MNSTWpR,̍w($XP{w h2 >j_aepi+r7nJ)A]yeIն EW2Ez(2>)^?G:1 $RXIf9pBu')+?}&"5F05/_chxHjhH$KMoq5) F "pú$smVN}L0]I޶ T0 IJa+\쮋K[<^wȃ]Q?IPfCg!ɟh3zJn,ԏyNи Kõ42 e)ظl[q 6AnHXW!= WZRĕH55H  _ݪH*!r F6ǂa 4(QLUi@W'"960@{70X\iqE:)4(쭹7W2BiaXa/Jِ[ +m_-> PZ Bp|a}<>7]n_RFib"s8(lgt8g<Đӻ:#*;կJҿ.),gH%Ӄ0.;5'O6>]\(|sA2 .ˈO麈2M'F󢰷"ɰaie0 Q۹W4ʗoɭM0_Dۨ3W>PZ>.sXn5k'^J$]S)4=i8{2T2%h7|%2bpzK9N2YoYZt^ZφwBAF;vt :|` ׫񹭿KBcoimÒMvˑ &`4$4%#pe5)ࣰ:zVi~P9spzflrQAtjʘ~ u߁.!~cFa$^د|'[W+>AY&r܎w CC; y'}=XRAc/-,}h# t@ң BEL? *5;qU77veZyfսRAlò %RJ"o^q-cgtI F]orŠŀ֛Xo@Yм3ДXYct1u]i($_P\y& 圽TR;%L HМiB/Jt2b_Ӹ. 4tԚq[處{gR_<=diDl^`6tb VWu&9EOY5yΛ1XW`-{ ,VJU<س1R'^e8tytIEm%;ET63hG[+Kl}ddz^f_uъ~s'JI*lFry9.l ]AHGɽ0>-9CIXJvR SpqA tE,naziʹ~uHu3H&VbbE@Oi)zA#v !`w,+ ܜZ8]]s9n,&׀@ynG;Y}Mq~Kz(OXDdԼeY}Q]ϒY*P-KFĶt Ђ6'Yc v̗1(\ޛAcd0RCۇ\;*Ud)U<&{6^.۽jXR=-~^#fr!:HmVd )FK@:_W<3}ԈwQ?Q`76{RVA Oo3>w <ʬ5FqKZ'QE .w6$u+nŻ)禮FW?ʧQaKRENIQ b|3d}0qŠG4QUe {$". uʌ Ct[BR6[i@b0CDݑ`lmxY(#QzK˔5|Fmn;jJL&sWy>998p\I fhHNo/#lS2W4UpeĪsa@ϗ( rԚo\Ltڝ!{_ [.~fGr ȼC( p,z]?$Υ|HI=Ǎђ hOK )f0#,2s;~8 J,"ȍfbh/1kfQ z"*88oDaɹ]q@M*UήےcՖ oӫ>Pd xU:O%0M N~1BK!Sz\iPdR]ƦG~'aWs-b=tÔB-}oG鸊3 Z嵕ەFTea6! :KCON5Fl D ]o)vOuՌioF5N.S#! ,]fRxzVCk#`G8y".R *p w=|63.:F! B8HCJo~f&#]q{"K/T\)[`֤K 5ٴ EC <.>jZ383p|Y/ z4-?uW ٞ i&HITs` YM!bOs!ѯ; ~p9LхEBԦ-t8 %ɺ0,>CO|xf~;uq g<8KA<؉;]|8m+٭]%_=W\6YxWg@ ݱ3ѕLJm⠥SE, hļ. Z-s)gH;`qR:`!Se2:3z'11Lnώ}ߵB=}V%G7o1%VMe:`'qi_F?eڌ@b& 7$&K`LN/~/XtCA',:kFK2X"%pHkuCO>}ks ?\4q.>vͻNEa^Jm.nz*% ]Cz O9YFH=0c]* (Ve%qYDx$YEx:S} $xMPT=re\+kvji\ N8hI3wLT$Nr$TIXv[|T`JĔ~q-ݸ7 #)~ I9}=g WU_}f}*+x]b$v/WA] f:7^1]O,b{Юqy=}ߙ＇z" C+8{P8Cbr4 z:6/ uĖS 蝰>H,_N=O/`J_!ZfS"ϙK-s% |*f~DS9Xﳫqk*rENCD$Ŧ{ӭ5Xh5,y)\و:U } 4eԷ3!LS_ȜWzU#;QQWTd74M@Zg}r{4+q}`UQ1}sVZˈKQ1|nrN&v?Ula4O,_'`LŀCv8z: anw^`V]2tb.n걗~f}X7;_žMVZiĪ6&_ sn|'\f_]uZ;s vH:wp$ T!qL똪3|Ÿ /&6a1o4&62wBiE99`|*zq7/f<bb r% $$9\gOH/BRBV `i9pBJ+W_]ڔk-@N'Ze{1gPu @V ZG(1$gۏ"Bֽ@&S3"-m2: V@r)=8$aRnn7GmG}R6ş4Z %G93r '׀w}My|ŤJĝ|CK\3 m|TjbEi>c${rOVFf% :nħ/7RN%aDoc^|Ѐ=XH!JN)K>ԪE {b(x 񡎷AHyid"Bdz Jꯣ9*Wh N-$"}FPfX_78B HL.L=C?Ad*. |`¤ԅ~p#LK7 G f( ǐ`_yYH^fߺS V7)S=K2-?ʉhk Vkhirm`Q/R~U<< y󦼐| Ar窱z4y58LF:JQKTR4ѐjw7|Ҕv6Vh52@1U&'44Rŗ1qŃAy.B(La/& ҳO $w$R l'{gyʿ. Q'uY z/Pp1J!_} Sv p!Nk/OT: {ةLJ+:HVPn"Kg (sT/tw$(UB)/`/[hK|S/*@ V"Ae/۽hE ZKm&8lJQ!Jt76׿G9md%y!IkesRB^Jwq0KҰ$ l]MŐI犗?G.:9Mȝ|]OܕuK:0:Kab&r'+\( 7d#5x7!pԤ۱OU9|mlxv@{GQDŌz"nW`NcxGj^f|z]ծ5=S*mVak3.2 i)ѭOȥ^OPjje>-aADTi^S,'TݗA6Ԑn.gd g8õ4>ʻ&2/5A<&BJXFʗhV XǷK9Y1`v^LNO^T6@ykrsK czUZI%eM/m2[B-v$14uc*YDt.XKr5,JCAYCqY!bF帚'A"'=oѣTuiV ~XqCO uX1sӕㅭ?Q,M47לCvd14)'đM$/i}T*lcz`i1㬲㆘U@/f|#)xa%ZQ^bO3i>G!|)X}\rz@~,~i[ڣ'6K2GbQc1e.K? S;&O y0R[YA;jərqesu &)Z[.čl{PN-7(5Ө #H G ]ԐK=Yfd>Zw}&-LLyyGuh5J]H7Ȳ}N`%pejٽ60D&&wikB9PZO`rN;m;&i[zs/Mon#LlKۤwh4*;}k^"tQ̰Q*.yt`\F7FZ !?Pkf@\EZ,iuklTjiҽc*<\ʵݥ%cE\SA"79U/գ([<(Y8ST_̑* 1f~\C: VC&m\[`u!`ʆT怭Dd n%/mғaj뀎6'U|t HelRuUeE =g.đ G6/ "#-, c]|}>2poOQYQԠ|U_#4%"F7ƜB/R;,3pİW<׹%ZvB:[ц Ӗ|F$h̒}0&&E=f<8/-:߱c$rT'Q6קQok`2% @Vbj՗M }ՀrzȘJ$5+ _œqY;T]~OqI"!ȅWHWC} d edn~R y@JhdKHS>nV6˝%T?˺.g1%7VCņǝ H8VLˍLkUq#Mv YI!4 ``%?5)7@<X_^XoyE%UоFqFO?^b+1C{^0d̉آ4rIb-nm[բ++qTKr5GkN62+at;YMc;TͷsXM)'caގrYR׾[ 6פ| ;_ R7D3D3 wL kp1u/6[.s](ls)Յ,䤛}EN|e֜KCZ &3+ P@PZE\,; bf*Xo!]IuLI%еS럥l* tb$ ;_KF'@$w8c%`pwNXMoB&e'K; kۦH1# a^GoDNfz?B1jGk0hjC3_|K'"aǖzK` -  \Ҝ@t$d0 Q6" ޮQ8 +z0 0E-ՔsrqԘCQjr>wgaԮis8b=?zO vs`nSD*s;27ޘ AѸ!%|hب5Mb˥u'ߚa崡,_}T>(R==KJtH*3z: J([`Iii7MxW0pd38p>Q3OC6;ݪNqvR-U}{Dt,*!/:QȻF>Ky7[ã bj zRt{]jݐ!|&QRLGCW=K7GqLN'$vq_︚!m1zFh]Ǖ "{ ]i)̖O z(BNLS#35r\t;9gǡ̻JNs2=i!fU՘Elf8{YŹ$z7:&gKI>zA?$4S1k}0$&(_o]л-E*Ǜ9\7/"Őa?cF+ TGZ}%[?81aAmk /7d̵":vuCEnGy m ᢒPEO^t ? aSV[Iu4.p:ON(Sp-?Z!,>&8sii#Ǧ"Atuck:tkƍ*]`q \w L^zʣD(!|'j29>٬t*Bf"S#GI;#,-iwKZm վhq_hd]Bח9%&e@So ;NRhp3 q( ̬w= ٣%an8wqW}&^,rbx%.EY??U8ۿi v$u>0sֱ$ 5𦾯VmWlݙ*Dauv7α5?63ł=xygȃs m{So=2:SbaBEmIcauӍN5vi|:il1i(CǬXgN.6ƜR` Hk=T'i 3KYu)G=B6rȅ𙺂?k&:4"7LRzSǀ9mKnBl~DC^ۯ m92Ful/?ٛA,UgUBb33,^Ld0`͗sE!Y>F n=Bi**Kj?#6Y ]|5& LsNȥ>y;i꿼󐈡q0j_t0Q&2ELhؾr xp8H'<(~P@<*58ZgY0nWUeíGڒ}{zB2#B }daث@`o8['G8Kje(le rf*D}:5[d"/(lgFI:49,yOv ,1=h1 }]]>T0f 3M*ݲB9#8biAPk>Rwg (H\k@/4X-怱l~q4<0C93jݲ֙6j!q. ֙Fh˽.&/ sӋ< EE }WҐ 9Ptmy~J/ck\SD,sRSF  :LY/qvH{O#S~c㮢rl4H0/,Uq.H C UJekf,^iIzINCn:Jn3ץȃA[x*t`k2[,₩W+ܞ66]Hpt+c"_=cxgY.vu̧ ?<1j^;W)= tO4IC蒉52&a^q9PbWg>  K+u*NQYuiݝ.azKSQm^=mȎ{$ygnJG3UrVY'0xa %hG>*J]AW/Ԍ+!+:5dhVdm8*ʿ%,F=:jl2}kx-6, .s8|/ NA}1N4ycY;,đ$py sl/R ~>+mX"bi(ǒGo*BWs}'ON 3U8 B6'㹋U-T3ԢFnT{p['zQ%oZD.OP unb ytM8x[?DY+G5-B+VUwPNwCK?5qY"n井!6 >c-k\u9kEQ߶Ŭ7ƅ;u{2b >rqp)'ڒasRdeYgi@Foұ/l|^fW,6w\nT%hdm^wJA[0/I? {"D^`Fߵ˂<]kt֖6v,6>H84 e6GJmsjH_SN /^P=xKu4۶.cC>2 b,*9g~|:(Ry~0^LC7 +)*)%ALj!& ֍a\3B2Rn/=#\ wĐAJ%+9\ 9g=-ztd{*R3cɃIҾs(qtԿ HT<7k~$7"\t\h9mUBؐ{>J#e)^yix x+6ӥ;Yzw( Pd,><xa*z{a=k >oN M7 ʂ<" /2ǖRd7C ECHYh˼YGQ9I4r¢1?a hf4mA\CtOQ0E/[6:T#E$s ~A.`};V?־g;S/YZXS^Z֨d-”96x0k٩ƲqI E sjy٘ʸpOn-${I/G^ lVhZ l O񭦖^KKlyDC>BWx P^\©YyI+F?ꓙӨzI<)4"&Ahb (qN؄"7i{xrS55 h6 hZB:U F zAE,k# [5U~M)]٩I5R"(?M/fN8&mxIv)Zϧ|B~(!hr(h?&.BGe0LΩ3-D7mOO| QHB㯯r!aЁ~zNфMYRo/~HH~]!Dgu ߾&3*b#&R"e| 1)$f, =RN< mԬDշ_(@Xq&> u!уn(z  NIt Gszd,s3R1K.nraE@9<(t/Rv1q]@uw^?Var;:4?lo\  {&Tr &E#4. (-w$evĊ+h&&56!*CF"p&{U4R ݘRO nZj87zgH,YA]ҸLʸd߯{)V.9Z|Gn2=p}ۢڬ{ 3#L/Sd׳vxfT8յӑ~Efzy`~`K )/@d `{4;U՝^YcpS>2fX :lՊRmVk*rQQβcJ>M,≚I߶qu{˸޿ KkI槥R7#uҗKz̋%_Lpr<6,wBۏvHkE3WTSmҽy_5ϻ> ~gel0ѳAhyeyš\}c]?zGYS{a];u{tB4 ?EUJ`DgF31tfNXxxW8"YuɚŗxJ}m1&&,ћ-9iuʚYXEMMM4UMRm2\W-@\t/R[dmON5Pgj`7fFxl*Qʖ=(vK5FaiL?b"_Yf5>:^!-̮$K&Ć<ח-&dLYi",rQ@/I|Q(Ne-ǭ2.3k|lH-jx BCjGcMy/,12 WڠdYsF'SuYEu46tQ?r8]0n?nͥ޶L^'Cӧj\.44}nyٚ-%مa;J)Ra#Mc=j^=H{  a ZI26+t`rt'("'!ڍ.v>>?8*6 \sigwCKVtH2c)9z+=?ff̝XGDP?կw@7'ڹ+C+.C!Tvz*6T]W ;eJAC'A52b|xiJ,1:wV"ϖKU58=UO\\P Q|~&&!"hU"u. rg;H!1ո`cÒQr@ J#GF߾&՘qcA6ݴ*Ķ"3]K,F]<`7=ұDxKWҋKy5Dbn)E--Ǚ:;*Cj] lܫ`͇ 4a4}'q2^ᖢFRL!+yG$apf߳J FC'G& WWƱHb\opn&b ,C8_s׺Fn

;VKtY2uӱ2~0Ucht`p6zf>>Jx::LܓE6[՟LD`nڮgMKK-!]-gɁدG^e <oC&'-Nfjh ɶZ^ɓ%Pۢ+ѵL0EE+%P ^ռF-kܶJgCc9✜=PXrs:I-%xB )\63W|`Q42ao>).E14]ns1HGHd嗄?W'5Z?Pa9 l+XBuphxZ xrq/loh_tCϾ4uM?xqS#_?+{UiPt=o @86Mk5u^ဩF"'BTOğڱ-^NkiN͢IQ0$M{f'UqMzp!<@\GddvD?;.ZGku O,nۗTSb]6d'iOa,:EFc/BD:A[[U^,S+D@p$:/Ryq89kcf:PJӿ@hPк3^/ܼ9M@h%_]\Fk>چ'rמ::9O{t1~(_ ]82%y<., f-M#c @ω2PL'FG2Sv]+ro0giENVߟX\X7BR_fK) o1XwߖL:]\:d\ yOc 2ySMFɩR"Z0mNdSQ㑽"dS4q5+*;‘Y|wpRGc$N~6`Uynؼ*SF2>,L\0 ۨY୹ |F=QN—j?)O7JobE^s5kR7q i }~puDL- $@ D8Ah5),⃾!à]_sJя(¯Pd%HҩJ9M*}!YN@Wc*N("(5MdBN)n>-^e6aU e{E"īZ2b9"ARLNwB]|;;闤yPgpo=G)@x;Ds}E합|!e\:q_%qsC_fCO*UPR.FEw겇F|դެai@%fON-I̮YA~"34=H hY_TOJU><-t8lt鷹[&7/$;^Z׽VocЙɗԭ] KGs;uM' ?X<  g6Oj_sY\YB ͔|]*»4D ݊[Y8K>[7}]pExz:c,Jb FQ26voԃd1Uۀ^ƴbc^ݜ`g`aڊfyzfmwt^'Έr+bV( ,"bU Z,\ܒy޽(z 3Xa +Xi,*67Xkdt\;!k5B- Xr"?tףלj@^&:}bSJ[~L2L4Cw1'noCw{ADi#9*ٮ{gAz?̉ʝk< SZet`f$tF^ uqQ{YoUCJ!'<"#ލ GZKYz7sx-/=Fx2r2[A(: o2Vp8BsDrep~c}>^Ls8d:svU\Rdǜr[{aqHgS'RWhWk:FIAcqSCkY㮢 ѹȃE Zn{x&B P1x,J.$bL6Ju9Vh=2Pr߼Ccun0^t&.ۀף *)V>:0^ ãl@O2=W,IO 5O_S@u)UYDi Űqt ˶;<Y3\>DmI٥'Ԩ߭#T.c ӵGGfzHťN烪+ c@zh5| f4'LetE\${H0\*tݯQk>(uƉir7Sޮ(2WyX6">A"=ʋ]exFs׏,;Z\U9=kirƑEKpjVp^ .#*p՝"c9K")<\9wR>!K̈́K`!FwUv i\JR{`PN vvVV i<ںG!*P qb\&)IA cs&ש3 N~r겤;W+έGлWLB,GvE*wVeElD7Bq?eZZmR7`|j#fz+, eDɣe&-7L)ӌL2`Ca%˷ί6.h$p)J$WP`LPe0' s}7( e%+[1%9gŻ.ʄs< %\>(E5^4uϵ)Fi PP֤|Ӧ<zՀ-r=]Y[щM?xtG#F,nmJU,X=7*>W,°T]Mo+F:D43Y{]Pu`JB#(lã0Ny^ǖ9+T2Q~Չ-鱨,suE'ѩɲ5rl\NfϘ!Mbk\6_ :_ީ xӅ^hi"$o=% =ie0En6bؾ(8l4n %3f.϶.dlLGUNM9Tv;iXU0/2V^{IjJO5l?[qHOF@J6/μ`w̃‰鴬wMI([ƖbA5o\vcb@ |ˀ6E]0Y](" ,N$uiM7,((_Զ:lt{ܐ遲o]euI,Taz "jeM65L-Q *@=^~ݞHE`y_jmOfdsИ ,Dzz;+0$Ȗ+'04~88흺hksBYXzhT9MjwF3_@Ӗ#xwudLt obbN_b"ղ@x%.̆)Y &!|" D˓MIlΞcc<4d'ߢ^ (1Nc'qRA@EFˡ0$ذctY=;IY9ʍUk7rOPdf /^[ 2>҂@kk+NcNj@>|LPxTURl9N􎏺dN<ߩdBVGaHSr`:G@a]1[M@yVĤoￆmTC~-fՅeHagJbOo,?jի{܆zrEG̸o-3foTC + 5!GoX K\r3n>4nj '( kC[T3`%Ƃe^'YFbmeemb_%mh . `*%8Ce::ﭢؒkk 6oض,Qp-|ћbvWϺcZ 2eyq<5_35~?a씉?kt5H߱sC"l̫Dj4ø@`~gGflG%7= J#) *n@p_KK% ||~?1+f3w#`'(T SJ9,(O]#Yx)Nz?\: K E'БS5xώS19Ma|$z[>7fU_:q gcɓf?TRq0a ~%&5J%Yq Al-^qɐb~!vE*@kSXxDp= e=iod)o`r|:Һqh:CmtҪ)<fa)mWX7hwF9Im6՗%?,"NjmU]QC`{ 6ݑV8dd2B A P%Cdfm1?^|]7 R8<7=Kf˵82[)7;_  lM!.n452ܜn> L6iJkH^~x;-ZBхDPɰ_{r[@C"CmXtڥ31-\41 }ӹ{5Ĭ-e@գZ&qKB,3`k- q;IlV] 6`/GPOܮתsF;. oL ɧEx-j^kl' ҡ;jqB Rlv؋7 b~pIԖ؏B6s Ousf8CBz/1t1 o31ĉQ¤p?xѫ߸% m22|d |V2qve )jд3W?zҜ_ fV߿@b"1:tݜN:A' ./Aw4-%nfٵ>&fYj?E21\v(pth\(O!$F7< 7BdT|f6C`0 N 35~7*,hZszяYn?|﻾{YN_Vׂ@٢m,+r<ވ/@#nVCI붐G| bfP(m$D !C/Śv 1kegwx?w}UeȣYj_V]%0c΁K@L"An_OHXU#2HXIU_g=~I]< xĖJ={4.,ɰ1tzJdFMj4 h8kr*UEwvqM3H4έP 45xF}U͠6\|c^l@ZE:}/j|YOsW> |ܿoUL%|[3$nNݩJH _DLĺzf hE }&n1AR?^Y]rܛf 7(DAhQA~!3# >Y%-0қUiܞ虳cʯOmZ?5˫SRC1lv2@wy]/p`tySvg2 y&?I7mby*vE"hR>*!n/MA-61l߈\\6_-ϱ_ZEXd #4"Fˑh{Ңs0+;bo°фu ;Zz%u@BA bP]9#J ZAjׁoCОx4V8T;gOR0nLxlWh3Ȇ~ uNF(4vYTŊ$];}ev>i7{Fg\{`13vXc~hVd' <ʭV&z`zshԮpݑ.{N7o:M0CA*y= ouW^To;/5?.YuTըIͣ%FJ=LDh'TNdn8uV8LDX7;‡HAzxiϙ@ؕCT U4D/O}1ƙ9Xm@MٵӃhdz^"H3hAuɼ+a[+~\.'DY=Ș˚n&oźa =.ʛ\aN?k0ٌrlVWUK4%%KDܙTYͺʻ!!Ge={!HD>DVzwat]t Fh_kT6·pӬTz\L  ڴ"CŽRb 7VMTZhtysktggr"hCDCE#5 C>ymE'Z 9'3:AmrM]ʫE+b)dFQ.P+27>wBGeKAI-ܞ-e/isy'q&QBB6n4ЁC-V݁#މ7)Xj\P_P_]BpF`k+W)/o\ I_{x̟ VN<`!8sدtTY ۔?$8 곐' d#٪5=7TZbЏ̽@D {:9hz($(WhF6R"CH=׿cQ3&jhğ 2WH u皨qUv&Pi]uZ*Gն[zIߘp>Enq+Xk=[9MY`y;0v)bYLDXObń$s'{%*lt̼*V!Hk :ȦDP=@R jxqo% .F֙s*ۓ'+î9ekF.h@}~AqKԄ;CeWN9X'[s|KRGyig{ dJJ/^cS/K~?pz)Ti~kxVIGMѻR1 qq<݊C"*dfy_$X'=50j#jx, ~=>}aGmbD8i6nWT2Ɛ1ܗȔLGm&cj3k1j4/ PJ!ޒ3>Jg iH岧qo.154d;|0 1'nM7n)3I>x9'2N# ok^f eWr(yKǝrm[wO@}dKeKh).2:Z1x>U5:jK${tc3.g-0O`^ɀ5FTݟV}Tvz_`S3|X I\i5O\W@~MKè?oo!}h Dɐ%6bdD@%ZoONX"X!<զ(%X G()>L ~<{I/v"X{m{ |^PFE8Lq[f>m9(9̋7ʆqcinbb8 s ppX (O9*`/CGW)\Vg6L6ZOɑ@<1Б$8wc삐gQCy3J[;OjSJK%1= 儡|1n\`ִ(!بƢ~\X,z(H4$?9!GذP@p{]]?k{"khWVl2scVadAs̴H1ޙ#C@lOuߜ8==(Y{^yWǜRLtmDsQ4Q&F?*i 4 :K6ѳ懮Hc/gr+WR9CUzr83U&GKCISoxc:ꓣFjV:vr <"@6q+ !B~+isӈUrsq}uyl 4["5%~l 2;kK##2/bTl0_(K@Ra T!aK.n35^D䪠b .bh*4 3OJ[OwCA輅Vr6tˎ )M0ݛr3 QZWuCkT R,SAƳ;ҪZFQF3~s ǣ1h ݢ1S/b! OZg=Yrܸ*$r-BLI %bșh9Ud`!}'c|X!%gǐ@C D+,BH ;^8HaR܋ ǥ TAurZHIyΡ!hoCЖa pWݦU#h C=ّǎ87}V8l_&%1쯫Ѩ);KK,nY'EG = ⡂ eQ~pu4J0ԍ@k41nV8b6 kpҫ}Ö]꟫+O[|wWtIm2jWMJcvYHՙ3b&oxk֒^6˧0 N=9E)YClb@K ;xd 2 ED[aKDCכauR`ٻoN/@4](imz tfyɚSO ĺV5N'rmk)>Yw{sXdqm7.~eK4?Fd"kΕ ;GmHwֱb֚,yM3\~ @Lzɏf; j(<91] "OKqqW{C߲^ES|@Fݼ;[P`A'1'م9ae0$ՔW RhG)]C"n8'NF{OeS*̟I&Pbrk;4+SQDmŽI4bs}K:';lm3I]*cI!|ZqF7whn2P]ɴ+7~6'l̷1~&@C3w#tɵ2Ĵ.|aҁ)*@?.6e ~d9C-}ԮSz>`vH@ f!-ăJ5,Va(5lz;<77i khDJ-ͬpؒ}%łDځʼnP<+fgh$4J/m遏ĭ]Gq˧;XYz@p(*m~y3+SU.f@*fLӎ0Oկ'H{!ҰBm焻s,گxEuG=_jkֆF+u5NçB\{#sf15SAzj36A4mjJND˰d'Lek3!<R5VH;~xec"Ю{\bDdAtD1q݋r8]:qG5 YP6^_W 3z41,zYl쬊,AvpFH3w;`' o.NOuOηRk 6ŘctF7a+O(=:) #Bt"e呪$S]1c줸o WsϏd9Zv:<ԅrQ>V7c aѥ:۶c੕Pl˚=Cɜk0R>認nA|K -A;QPmQk%ow1eP0`D4FӹB*c6y2 I!`'i]?OaqG)[Qê9g+Tg'r{T+q2{˓xb&#Ύ$5mC/!3>?^k%:J7vT˺[v< 1O8:5y] E36|?7᭿iޥn͞K!; mKw08>RrX]R"QSC3.mTCWeG+h(\AFZhf{z%Z{bt@7R#:Y"|. 39,N(;]yE}͕my\1ˇ8biJSBi:&<wŇr 7=wt"Y6j)Q$]`^KսYØ!_yTΜ Ve#{-ZjL=I :>DgI9{ _捅tM@ᱸ&B 1^L-Dәuxtݹk΄ޱ|ۧ_RtCџq++Z)&;z7KFðhM)mPOVz]vQ y) vFq!IcFr@щpDi`1 Lk΋D<Ҝ U28*{;8"t7WXkۨzjw[<<jEΐSkR^m= Up E~n"6i[7rһ6~k 9v ]=1~AX!}wQ)oþT0>m A )/ ɶjցA`,DvŬ ͖"p5Bs~aJ?͌?AWхJb%:]>K~@8P4_-f2ĥ-a0J=w&ىEp7S\k NF {D,B CZ)?NZ㝯bY%OL,B8[ ." =wĒJd1gY"c#\K8FLsCxiI3zgLA6(PO|Y7^)+8á hWu9n>H)T G" HLrM?R3 6!{D׮ա2N(o3(&D0An BEDs>?=nvL!K -`=abAI /29‘0(SThĶ7\$5pOS: 9&;IY-(.A]K8& $K6J ([ *n_Km(W^St#띮'6?~xʂ(+߫,3XA)=[;k+!E^Wt/ +*V?H|V L S&j\(>rw+컔ODg\ )Co!cFnYn.M2M\iz|VQ[]qQMF/:x^'+/D@"ppwё8IA;<)5(,FZ"UbdxZZfZUsbq@EY{@S({*ZKE3k"H<;٠nIe{hNKK)J=4⒛1Ak6/wjFSJ[ݨug ?yjn?'9L 2{1̗`jA~9{ 辑&vO2ג F8ܔQj}(O z|4[ϊ [G46R޽ǝ`&+kvIufS`qpxxMB@V%Jm Yű&O|  O{lI?U J4f(Spl#*L$+*v KHH3E/&QQ$@E?t3ja"j}_z oCr~n~Sun+ VV*_Ɉ9˰Mko]ms"xV YU=hu@]"X_IBʵhtso̐zItFԖqe ҊDP*I$S~,x,l#/heXYhwnʜkHl]d96@Λ5>ےU{s"}ۊ_*u'R:0йp}(  r8s|hReƧmfle8s,A2ibwu?D,lRH?Np)X? htnr6($# Yeoj:Y2ꡱ8Hضx {?.MS,ڒ@d ~ r]v&,dDZn׳NvˍC;+ cq4y([Q~?˕uk4Wg[k\Er6[EgӞ~M3>;6dr,WP3 U LUN!;hr@ [Ƨ"XV\&IW1C.*T@6, &!;k߆9 /Q1m<2/kKkKVhcӄy$SWkNpp5eIBak XJWu-&Rɼ؆#ģXL@Ą{jF:^6nSR3#=r2l$LBwF*5!C/:ue ȠbN{$H*x>Ym}Rwy֮R2Pz G"âKNn)v 67mb2#VG0ôF\^dAz7``=OV7hWYAC~8]eCWM+v)=QLv @;͚)z3d8bY*ih6: ͌Rbۼ#5Î>ٙ*YK#~M+OrԒhD;?kcaXY8ڻgcx'%U^]c-:-2x!ݩOnivH-*i ZvQOJ[7l}= 02!bWVucT|HQSΝ$woA$l(W;5c=y 63=is+Mٓ04N{:Rue~cd2:ca!oMWf-9ȗ,1+5\ϲLĂT0>B$h$Op@3k66TtHCDsM$^{Ud$½i{V6bM9z)ZHZGUEf|t8=D,2Н%VcglC}\J`tbܝn=p]igxDy>e[_bڕ4bY%z&S{3;ֺF^T"A<"jO^bi&YKy앉{?Q)Ep/5AHVn%&{qtn)a9[I|aRN y)Dv|3 y=߆CfNȈoh_ Ŭ*Fnxb<ǥq7k>0S{%T#^wvm FS0M2M澢jݝ˳M L_NA-'*X,!)ߨv+`1v}H n@Vcwq/EJ;Utu_:1XL3 :ͽ_珶( Lzm l!p<<양LM2Nhn"RW ņty8Id#o輥8|\c݋糨@0V0u[t<.SC\3Ou,/Pq4}G]=Z3 mR4kg.M:+7ɨOu\ȆK}< TL\/ATN{CcH=0zK5&}u+vs̺ Hwumel1S{ `z10edo)nJ.sSI r(=n'&Yj€v !Zф` 刋:q1h7Þ}6(c 1WJEjEѥc;/mb yz eMU{횳ήٽ~) ־j6xv Żǖ%>#Adhn„VRS.Z Ԉ @ жW@.Y*`x&wLe5ww|OctW25\E c1kY Yߙ%$*^gӲ;MagoKywnO -(@rCVbR j̔tjgQ]N/aV G\ŸLR]yL}]]&MǠR<("!-r XYupܢx{7h*MAxPn~ۑ#!. n5;z./u7u2p$-mHq_|o962twף:ig{ɼ5rW96݊w Ci圇0S,GG%j/?Evm@ÀoT`krtr8dq6R YYok+8nW491ɺ1h{"Yv+0_ Vt/vy(( l8$SV,Η{)ML+nnViGCNUj,4'B*mЛ9ōNO\He]b亩up!žz79V(w-~{4h|3! lX+uVbO/aI+)!Y1+OzWh=):h破̬g{.*)=jm&fKj O.aZ6.B!cEuICt\Fi^0 ZT"mаdŞRIyS…J!3 W."w~Ͻ(Sv5=.z5%09D0c"HIZ8ohv} !b6*j#=gV1C1L:䎋/KY5?zk.~CcZ!!1L^ZnoVsl馞BWZԐ 0XIj6@xhxFNuwk>$ZHؑC"'p $nqAbIh[(83R,s!sEK擕~$Tc91RJM0n @  .]T'l|Qk ]l1>D9;%R %0,vgż<ݨT%&dcBͰ@[*wGv=h a > J0ŵ_&]Fu^{,n"OA\| e!D&.jJK҅x3MՍ))5 F/[Pmfe&,@~֍*A[2z'M а F}[駄;$HGSk"V3wvNKb@p!7暱5Q,/ء0ͺk9ri`]i6;  =0<[{I"W7x\D6~IMZĬ@-*6zK'bI{Zb$SPK}WRw,q ++J)E4<81OAH&,"N<†  Q+Z+d9;c;s$1wVk0ͼH@pP;&5l(1cӘh&t^S<=+vVc3 ,eE7 1xb6(R{#"uf;HtI2`(S} Q XL>8#vݱ&ǽsYq2KZk޾δK7=rlzLTLD7|ƭZ҉i!5-E\ ZiȼN#H4gemD+09ݷ6fx89&/ôU3>4!f^lCMo=(l[Ђ$IĹupZ/!%&zPX'54*;cW'5wa % ~G5so mh~p wn 7]uĐ008|d.Tƹ`+!(#viozTJw M't-G(QQ5hª0$D C^Κ>zfN[{Jӣ痜iuyΦ3^R0h}),HR WEM2K>3fo9 ꔌ "W3jA몣oͻ,1H&Qts9uvmAُkNR/eˡV:xi@0MS _ĵ KZjbAeq ._0a[y6WEqJWGxkq(!D"0R廙Lt|rIp1+ása0%>Өsqrhv,>"X RUQZm,/#09}SE'1 cY6SHݨ Hv_X\So[/g !yB/R,QdmK.pMFUAcp -}&+2ʀr Ｅ{B1@2F*.\_0@Љ9ٍ{(א]zix]{'5NS?XBB6eX)SL:q+%*K+He,WuJk%Y%(+h6Rcgd7]{8NyoY;# g9 Ӭ/!zǖRJDj0T#2Lc=_B{gY!t^qJLSg}̷잂iPCR3^$mo^r?:yV0,v0ڛM<Ӑ֭GCCTDI\N 3Ez',. D%8N$%6i{&!ɵ B" 3A90 ",5% k8Pr`;{Ҟ"eӬxě|H{9˥Bz *Cw5>as*~ѨŃ x$X| }0^D`YbA#Gl Xk0%2!8z$L"GVȽpN@tBu.lF\)nv˙[F;!m 3)VVhk!*ejYzUoNۤQ ;:遧mGŭ`CuЙ˝j?A~S+N-52pvܳWm rƙ+A XJ\,AQg{<ʛ!gS%AG$9F:"P XFHAų|a sE$RT- 3It,1Tx F;zFƵ\L9㛛vInפs!Za2{ dI[E"B֌,%0܃ {;$eZMԶw=-IDss8KƇR1Nwv xHc3}DCs7Zmaͥt0 ZhZ%#a;RsnV?1L߿" 򼾄|-|ࣼ;R!ax%kjL"-%˅=Υ}/.՗bByklI]J %wZVkFnl_q-d"C.C4P}3럗70Ll$@r;F9Kڴj.)݆esǹ F YD 'F :qR&-PM,wbb/zF3NzKc5#$fؾ^Q+K=jTC$!v6 (%79k7+d.&(-cp؃BVj&)@A,,R#g'[ae)8(*?%Wiwa%sjT\5=ڊ@()[˶Ol-69f5 քa7AjX fAxͤ=ԀiCSc% #[4j'Bs+\| ikq& Qj""1#/* P:8E=D B jlcʭ7UΕʊj{{NBn(a)3iͶEÓ@mUq 7~?m$Ά%-m=c&RJޯr.f{BwӗNu>=|Ϙwu#;.i I@RM$4$)Ir[1%1>U@~$L BII $H{DiNPH}I R@!)>v |N K,4K$в t$ $@>a$ ̐4R@I,HhdQBZ! $ @&@ )!!$l@$H@h@ sxX@ Y}JtOa$!@ b$QdȢ$dIkx{r޼s[`N@;x.Nnvv@$s5e $tnpGOj4ntI 2'9Y5ni~Vяu3i~.~}dHb$rt!N' sz~ֱfH2~#dwã:FM2>q8fڨ;tNGv,7!2$ΐ W^i2}^>35, "EA<>M99=nlZP d@8$);\ɱ[޵'[K4 dd挄.Ɂ9HBs7q|A7BOSrmh: }JHxrS`s9XkttI &I7|u'CGO @ PZuvOBjܹT!'BHzBzwP KM'z{| {m]!$jK-MDlRþ̒>foFO[Dta D 5"I B<τ'A}M;@2`q2d7PHI=Iu!ʠ$$BIaĚ\x:S*[:o3ZZ"IJ6U?W2ODfSy`$ "SѼwIM,lHB1PbHfpT*5}g|];wYyJ ,my,K."T"xcCmFƒbnBd6MCLku_jd'wlbu _f &'$Q t) ŖqޛTaj~jqNγ!ETP D_H6Kgw2R?aڹQ߸|!j㳨̺=͜&es;̄9JğMmCFhr6uw-~F'1'~j o{:})@IdH5i,l R,G(g+QJa>'xmޔu􆃦ܯG`L H@fV"@B$ԚEzz@ONӖjS>2N;nO>kMt֊y?od<_uDŊ** ,QdX}ć{ |/o#Ir.p=LJ)^hKЛkl=i}'W,뼜~Wt2W<_'گli7֥PD"$$!D4a[>.¥$R1k6&w_'½w=hu_5AXȲk)4PDT/2њ*Hi4%&%moC*"=y)Rx~-q"ؐ-ÝD mTY_>%31{~-By!v@ރr>s2NȱI!f7a1]$xmy{uνs:^{;q|u ˻˝w8ɞz E0-`^[ouF$b*,fghlB,>GC ~?Guۺc˖I̦ %P L׮JKv1sLŹdYRM4m$Eu{G8q9{ӺyEUa{:~ػ >迫_ȭvSG5noW>%6mt~?oxg|<{ &os?ȹq@<:O'@dSӿVrd-9%[e㸳+ߏ;G $2̩j7y~o>8\;iEJ6SKd;( 3DmEȻ׸3bX^fͲVO/}v *_.MWSH+gʝ^Si>m):*տ<sn ӗl%ŎW/Z\?W7tg0xN2MtNZĝ}X!& MǯkIdtY5;]oliitl{~ꍔmvH9y7ꐁ$IȢBdx:ZGf(bz~C_^rt֎}{V$HBj::\{؄:z;)ߠwrUc3~SiQ7T(bI1dm޵mš}8ڶ58o 4AVPKK"ARP D8IdVEcY$,@v40 DT‚ëb2w )a[jT ݲ@ޭt;j :7Somz:<+o笜U k:i'U: $ꓮH$z(qP ǷB$ "BB0hHq;\m >a i4b8$ DgҔ/-+TRvD_Le$M9dȟ<f:['k&r)Ti1D2|R 9bdQ$BJ ITC<AfHr$; YI$6ĄIt9Q̞;$2HjxzVZ);Aaj5e:] !w,ŰGsIcIUEF6 bEM'J2Mǿ $pM\M I`CeyBNsKJv,8^^Mz0x-.;:u{2$ȓ)ITH,23i[U!VVfaMOS3" Ӭޠ~w~I' +{nʓUMNjBsuԮIf_FNMHw!!MG٦fcJEh"VT}2 RYq@FXT69=,9h- !5Yl:ftzPBI1r<^|ƥgm!%풒i49{{~G^Md9/Pz ۡ;I~gۭU욉#FS$f ]ZtI%I&DP^S79!;2N.UK]Y0Bbss6gN'Ojjֺ-o`BH,Xvn_cѱ e5;Uࡕ$;;7ݎ j$!9urZsrtlN3LQt99siLlݞM:(ۂl8RE0g)6pȣvncHZAJPa %Ič ZkVf~X~64B@0ԁ}j/')wm٣ Rvy:l͂(QA*{[l榗Z4x͈sy$3ؓh㿚kpp_q Z owi&9GZgWѾ@)2;ņAPVriPt\9;wtI fŽrAlil["2cAL7yv:+l!ؠG;jd陆.$ʮIhvjptүЇWعd N5͔sin_[,ұm:) 'U;kw7x.C]4^ ,$a2&n-]>vh@5׵+ʹ.*dBB wiº=ZOgG*KѐV\$9 Bqv(v!20 %N9ln 9zn$SkImi;=;\o'[fD$$N7ogLY4w]M[n ;21ɥ23Y%"hPx] fNۗI7@0HscsԸtKG%pM㺤WoWwVY79lfAks-kS׽sxow]ۜwaګ$஢vڜרʳ) ٗ.:ՊR&URv>̛9Upeȷl_Ɠ[C\s [$ӝkkcx>ޮғ$6*vߠ6 rK:Ra0yC$Ût>&`TEUGϷ=r9۲XIfI 4JBMMo7cfwGj:{09TI BI,~J3$((TƬ`*F-nD]!g9(yGyL%YCiNr%G;.JoĝP:>nv(׭23)"\%vK*f"fBc4.G9N0:EҋB DQQ,e=qV F*BD&!K UN9T"%Vf~<֓VIre'$! $M pĄa((#".ӂbaO(r\  ҊD`d VK\Uo&3Ț'$ WA<Ò˙!2ʀ :3F9k]>Z'+Nz<ޓ[ZJaCRh8>(.zdCD REtpI(I2Zk=7|HN݅05HHD$Ywk kiPp/jc>t^LE&TA&:NhCuK,0#ㅼLRB"Ǭb>:BBʠ%э`91.Xx$HƳ&̛9lb+k6d44P8WѸyzZSo aU"*ETF[냑HM ** (*Y&_kwbquJUEEjr;q|"xJp[˟ ep BMXַB& fh38 '*qĊs¤M 0e/fEݤ"+z9g2[/:3*7bMf)I@/v B9,} 9QlHȷ1嬒z*] \#W1A10^q@3-Xi S-dBǴU6}st* yB;4R20Ȳخ@=¿nV~$)e]K* S+Mb12Meˏacf]0@8P# 2|-Н2sm;0HJJvv{ޖUd^u+w/N0@} `E"q)мL\рxQ$4 "%^Zȉ;"N*YKb)^4#Zz 85(P:H[[eycE+VPWOE R`%\W)09iѿ='ZS -g'%ޖP 5rVO vdg Ŗ)v^8A=f^J^[ƻAWMEi+h)C?&ndA\xO  NJȽx澕0d@1C"&*IxΫA2T· @/a3Zdo@H-ՑMBKyL)ir `m/G-g$) [8$z: e:p-OeV  aȞPlJ g h䣍7 $2+H"Aor/ ]=~yMw dSRx ӫ<ؾ͚d ;&qVЙfjAqW^ojB(nP˲jћYlÓУviZ>!>e qP\ʜzeF>m<N$D_/c\AJ f*AtmO-fK"@"wZ`/$呗|jPg*+wW?fȮoۏN D"-խt۶Uvލ;c?BC'=碬'$YO %"SeS@?yvWX@aϲtI0VÖd0e^).cDd(q*EY #g2|`ZJ"g s:G DK|\ BP5X{2bX0ZI7 B!8MD\,cUX1"2)!% ͗1[%U()VL7<+.#FTcTSO;jҖC4ٱNgoDYr)bitgHr$%O=B" "G+Elk%{@+Һʇv.Bx)3 UW~Jiȅddw8ܶOi|V1I a%I$ɖP".T;3\Vz) >xT4o`ʟ=jЊ㉲.P;;7d]ڋ%i266r?U]F^#I#޻ABB"C#w_7{qE ߳cVLƨ[J"x6ET.?ZA1l\o2qHj,`ViÈ!i•hR*SW8f8@ ʲEC xԻÍ`c=iMslhAA @G7#"$~l_mIRHфS)@%k]7G..iASj@$,4z_t>IAJR@\p͵g^fFn ;sU,U.mȯ\[2/Po\eb쫹N^:M(&$Zv]ZUrk1.i/Rva`BP>@}'=RTWB@955!DpHK/{Yغ=ss6{?YkBpmO:nېw|Λ3Z>+\mhV{o5jo<3z> !/UU珞{(WEuv-2箧ԸVGj3!ŷ^px,gr6zm9HWrz]<5GCMlh\x x=iVFh4[ִGKݻYqo.z+Wƒ\yƵ.IQA}6q 7˖ [q.y=͖ qӬ_vS|dM9?[ɋu_)Eeh)4|Ӥ:n'3|'6W_m3?CY<*RaKo'^i`zV/s,6}zkBOk5 Sᔃo5o{ŷA((9OwVQԖ)-ȿǹn2ϚFl&oYZC0&.,|x Q&Ul6H07'8,-c3;d3f}7Os_Y޴=OWLY{/m\l^#w{ PBJKEH60.7!:q>C׾zsNyr=_ӯ{9]r;_O/C .!4$  He M!),$ I!p("$Hw;wϏ>:Suvy`H$Sl(DpL&Ce%,P)`!Ws|P;{>{.w{ۓ7oPP0J\"!K,IR{xW!7 'U}ͶZ5ykW6CU T`@I(e7#z98(I+]D L(H* M1J ȁ)`dQP@b1S.6-I " m5Nxqv ԐTaA{]{H6*Pb* Ʉ~ Ld&@@ RHI!JMtwTWuj5+k 2J+E%.0=ϝ[髛E\WU_hέzZʪ$Id+N+-Tk%ۡ.طɅU{cz)*$ܐ`_4U@K$A,0D&LlXTeP,dZgH MpPu@^aE4S!narF ȣ B,C " e$Iޤ! %IdŔU_jkm#$k @ŎJU@@խ ;vj/ɵkaͥA5dBY i(I z_Akd5 kVZ "mʆ.BjY lt’r`A 6\u vhBW"EB%U汗jAJK1k b̨l,duP1d0MfY* )!0!%0'UtC @N-WK1KM0D<e2 JXeL*]*, H0@Id %d+ &TZI%AU! Њ1IFHI3 ,% !! %FA!HvNCP-0mܡ \ؠE&(`Al@BId`L 2.e9*l/tlJ],#gW{k}ͭ\ophnKIt%I%9X]mR` D8 LԆ.L%$qĹ fEj+$$PRBL@jYr)W,DV.Aj嘁KiP .$FZNA &&Fƪ\0F042ڴRأlJ0$̤@,Ip#""1o.K#AHD UL*iL*^@3E oВfL)%]c$3$SQj&Jl*%@RzLqWjU38:a`e!`'(ڭr65B Kަf.$:ok$v%ANYve@IF E!R"-j,˜Y`$ȅcP e.H#Rɔ你,.lLd$7Id0ecYl`يB2ީ)!HL!R2csW@I$!-g){՛D$ D 76LVL6jq.F c UHL24)[- S֥`VI-j $!)2*LKԺ6f 3@"i@f(4]Y[%*t*ș\PF@Y!!2^1F dd0`xH(4:R0m(I7 @& ,7ET*(S5 iD52),^e,flҋHT6T` ^3Avе;M9IVA )dpC;!)~2R)  ̖TKݦdX!5[;"D2Eb mVRR]Ȅ)2J1b*Q1I ,1DPL&R(Xt3/ $$@2eQiNr+Ȓ(( Y $.4*Ahm1VP@7!P@SQ!jS F\F+o@ B* ŢbڔJ 36l Á  U"L'N$4&2F+. +!rk[,\DZՅ%a. ,ItDp(ȴ̩B9HT4rX2 (@F"%qё!0+- M2Ia )LșO;T`A祖f$"d! T)D$ pjJ(KZ ZI 9i$eFB04ŦpAQXTAdSSL\Ҩ1-QV@ХX8`arn H…R.ȖqMe9HO q2C+%St9DīÛ 3!$JloP]eVFUS!HRB {<;]MkJB5QR]SCNvЎ R쨁)wVLT{M !(6؆YVΙݮJ!C{S%Y%!"r$33,4!%p P $!$? L} sT@P.I$@d`IT@lPVv[PQR ""lN[ ). @F v.T8Dޡz$*""08:dM$9)JNdd0A\ 3IL+KY}7[T갅{:INUmm~cZ5{m5UQ̒`ɿYwZd” I @2gi!-@U*XqnI#0me(t^׬-VkR“:аB(hh{h}$<'/6ՀBB&!|yEPG^T$Rb}җEi(̻͒z%H4 iL IAmH [E4NJ!M0A0YXPDQh҂A eeBRQ ./ssǥy$r9{2>wowr#|9g+]=^.;E;"^|v{/^9s9z|> {<2-% KM Q D -Ci4چI҂H ̏z;cw_=y)9ziim6B2L@$)427_ǗsG]$={㨻vv|^\ !-%B%†B,$ PJ.;ܗoxWz{."{u^9p#w7]q.wu7u9|=tbwүi $З0APebJ{:s|{r޸"0)% iAbS-:,JPIH k@% +S")!0EL*9$0|o7T4fC,nr-W_yE9\wZ3YlM6?]>YYyLl S~.0!U]"jY7pN|o#~zB.Aba#rz n6 1^>qԵJ4~tϐ!wFp 0᥺i -V5whi)&oޝ7g N{'hKu<% Sr]:]wWtLu#OoϷ]hub}񾗦&?F܂Gԅ=ӭm1IAt/GGλt襜c쬽ÇfD1z52y' {7Ξ#36 M$\ZMEgPFށWAT~eR~"6Fu͘O4ؘ>G/ui2Ylj)#Ɂk~_+2qX e4ucf\lն3ĥ'׍ոx O·Dj<3ݷ׎,ʟoGzl61|ݾ*׸!DHBf,~'˼ox߸صp:Mq}Y{\jg6Cr~aÜSu=[´7sCߜ~-Dɞi}杍&=,׫IFI7˺t~46QK-@i*~fG?":=We4kk T}Չ(1e:YC118R}XjeճBTk~ 9Z/B.կ=Uxfr!#& DUnLx _^\p1dYVe?Ef 当rƯ[/y BT\//λ\8?G>5{=~jxЙOos0qtM?<5ϧ{CeSgפPIln>Eڶ^~agv~ .˕yyJ ]KPLKCYXKߺz2k[<=%#U ew GSp]¯s/zgՠmh`p>ݤS6 {}M>zV>ljS{1N{%$ל7{ "޽W}Ž]8 O(T`0vX7lX`ܣH8+-S|UJ;T0Xj?(V ~ O^W*O)35[r,߷PM 5.J#{~)zGq?p*|-ei}*v֧”JCc}Xɶ~dO/|uv#ҝSgxck1bӪѲ\k3=zgmݾn޷SCN\=ϗ%|W}%w,Qۻv~lyah}nnѲ^_V\bBoh+2*Rc_kb8=.7yevݽnGB鹄RfQ4cޓ13a7KӗQP>|︄Tp쫙XBRg:>%f}GūnbOQ\Wzo&[5Z+1W˧qh+^?]/?ҺLJu+޼;͡zO'ן5R~ }:fpUd2ośG!n1wƭy]XLIUQv:jf)ub3/j-Yrl\W ƞ6+R{˪?V pq9$縆o,"(^0HZ!Vg iL&9S3kRDBSvIJ k~iT4UD>06fcJDޮ37^x =w'h_ [;LH"L"JJɑQJ#PeBPKcYMfPjQ+sUge ӎD򒯤{Z]@3}"zy_[&

xÍU9Rmq/6=W͡}KJȳ@l2j]N6}ûךM7`sޯrQ>\e\Xsj{;Q[?S=z]gdFYFөc #϶7hblY` m\TQ8xr g̫6EM^2֗,"t͎5t %pf=uUaw w9ؑ*\kXӧ¤e@Qi:\*97,{U#2_&  M~dhY-ҽ2 Mfسws$6f Il:`e'&'!ܼT&sWN|^b>×*WHca'y*ŕVRkO[PdRTe*L6>5֯Bs16~tTF@hCRfƮe+b%S쇄vS3+XҚg Yrna@ݎhﻟwмYCqUOʋ!rg#!)2kӉ<\kWk¨Red&]9Z*e(xSAC.i V=PIdUy^˩,ʷQOs*WJZ[ Ǚ_c7+_ W<%X:wrybh!4sƬ&gwgQ=#q& W2{XaZP=GaYPlS9L2DPuȂID6*E uubrmi!99>N*h4zYF6@1(xtb8RD:gdO{[>zCߧΦYDbgҷIteUwp*]V߬=T޴CQ9S/+>#VQ?;ڑV G[gZN#_^r@ZI:ِn:cbΑRBf47&dXDTbMkl pPW-"ify]`v?.D$Uxd9鷰2k8 of #mO(XqU<67wWmNُ-gvvߟ 0B@~9Ϻ (}oj/nˋm,cYw"}n1PԻh| ϻWYj*d7 zF5fZ ]~z\Vyx5Lܯ: zj{A'*n[k gm4w\?'W߶4Y?kt7wC =}v,V~'ːwlo / nG,KBvowڗ]]9:źsR뿰AbCMjo܈}c,tywmָ >T^W[u'C.Lw<1$]8gM7 ?{Wc>ο;\EHR0vz@B3"BE:NsMss9fsڭc,>=H!Xgren|r3^ZA-aG>7ܶ/58{w|^_* h׿vZ5hMskN&vuyejӸvY~7;\;+?G$fwXReS`r=R7c`iܺc܅is\-+oh Z靺+3Ѓߡw=tƝ Wίۦn86?uN?OU/s=꾋Cfjh/zi/E_yûs,֢}r?φ`) Ą?2CPHC2@?i$'礒Rj}BfHy,$I22$CԐ2@̀B}?/s琐&W?gנBI\>UOrOdC2ZW+UWUkZ6ڪܶUJHKB]$ ?nؖq,5~:}TjmOJd@>%HͪU[mʶā$!@7I @[lZ[}־-m[j  n2HLBOI 2d=uN$$eda'M0 ySr42@!a!HM_:(pss~gY.%A󼦈OS_\+opɔB4+d$?@PH6?Oío54g_Ce"kP@0?ZfUD T7,n'M؜pog\b4(H&zI)Hy,P0нvxi; c(0e #x4?.Y?4 Zum`'vébr Lɯ$DA yH\ִ E\5|z0UH'\ !!.^6(j4/d qaJBg(!&we8]D"; XuiQ"c8{7kJߺ>{Z"͂_Wj],G6ęJ`9wg;+ т~7LhJa%#- =dm}]awtbjqݴ9juxڂepĄtLD5TI5= #{ ;|o!F{x,/B@5^eKUaWWB!r{o}XgǙ]o!2/ry? e $ 1Pь&cN`?NIrFjr44YMz;QLE_|gl GGVU] '9?x }m4ƌ0sQоwUk$ b>RY $hK:X4`dC ",PӽC[@ip#>Vi 5f&8a{\ѳFXCY1'4 |afrx@hS!a 2dmVf#, 8O. kf #.FT,Y@*I;a8A,( ]:#0jGϜbrm>q/ڝ?k~/gaU̱rnw Pc\`,ָO.UK"&uε b,$7-a?O bRIyZ{Ȓq' *-&v`LF(lJx*cbU**( Eм&s|7[6X9@CM_j/9Ah'jwWӢ:Q45bjd(o̯֪_vATHVOX,C?C´`.C= s1=z4.wm6K{_kxeQfu3rjy DZobh:lf#4LjJV (I79`?7` t7=\΃` m7Cq ŭ-18tbfkșɚXSkY+F遃 y!$S ,$BIHHT'0n0Y $ 2C2@a:,R0 &NEb Y'1L~74(oǛ]T|4f3ۻ;6\`Q#Ql@A&͍0pK'q4&'hd~9R6""Q=)=zkAfv}uN Ht奚A鑳D$`bgtFLm.Hb,@qa&~_8uuD}Oi:dK͹plvd{'> i7z\~ P:k< h#YƄh> |V~x,.uJ!R1R-` OPdS5ｙMKL[!Z'{}r3 D@ ܥ;B~$!}pL4'Rߠ{% D!C!ʕ,,,jcA# pa6x ]qy̕3~Y߭Ek/ E LfhoP]p<[ʬݡs_Q߳9|`TgX]n` bA(*)^Ɩ0 LN. I1an>h XWC0 zK׳1Xe*7kxޚUDF$'J. (S?EebOni "KB,x<8*: 0R8345]HP6`t aot ۄ('QA1Qώ|0sC* | 1FttdJ1 B"9q ( acSPLa}$5+ٌq%Ti1r/y?74,ZKYlt* pC2&ֈLJ I`J&13$%R0gR)zS7Y0xxZo}wSr.0JMZu )#^s1)ؓW9 <~ )`TћA5y͢}a6 "J&(v\J?1ou>ӊcD xIp"t#ϛ X- a uD8լPXqmXⳑf3dX`xDX& G1KʢEdBlŭQcW*3bK7FUfhI ACpX)9HF(DmVSR&K/z9+bGEŵγG5-UF'4n '5j_2RN824u|آ JXrj!VbR7R1$PPٵT308^!#PnPtHfpjQ"]Y"2 5TS|fVr n#84˘W՜7rTa2Ew+T ֆa??ɀVld許1&hP(slkiq" [ ui(|tcy6eW{ wg2\.gD3n .Uk|xFgXY?p7VH'J6/_)]5>hֵ9ս/4 z$S| xgOsWz֞^u]yj9; 0bK@P RvBʖ!OeHC?6p!2H-, dd.HIVgZRHp $H|6BZ$i$ yHih:!-RH{/Ѡ k2)!%@$ 2S$QtO:L$(IXԀJ jIBB~ZBICaI@ bF$L$? H3 @ @ȒHR@1HI}xޝbM,uu3iFWëuru?wk0+LtH8 w)5L3WNbWǁbg{3Or=^Kˬ(YRIk_9S.jgoٵD(o[xi7[jA+2а~=dI[z;L>6}fӱ]ﴡ&d0М"]qfP51! \h:}yI)Ls#]2a0Kj绶R~$Io5S2n-_$8CXi8zlvU2.^rxT.).|{9ow|ޛ9绞+dr7ba%_5I[b1=m͈ k1'n A`bF1C  %iJ$gL} $8M>w$w>Hm06ӕIL+^/F\@S ݪKY ݀A$!)Hޤ$ US>PTUZ;5U5-$3$N 6ʜ~/L&d@tvlwܪd 6:tS$6ZoK dwo̼W:in]zj{kKN(hSWKѮ|TOYD:2pDA ڤ&X+qeu3辽|avc蟬e}jdVەNM&ڿɒ}Eb',Ӧ0w}>C+ v_Uz.3-Z*jwr 6-2ðMq{N݆Q4xwR r394)4~-TxHLoK%JTuʊ'{ 4W8\[2{E-w&ٛLQt=]6\T>ޱVSL^Ľm~[ǫy~olέI )Iɻl6wm=V>scvv?M k8{a~No V~sOMwou!mK'3dVݹńmZ!FBWDm:3@9t a|ǁ?*|MW)b?{ Xk|,@!b*HHRB mEY$&iv2"Ul>5$An$L.!-($ K$`S!OX 3!>.%w:U9PZ@AiZ($DÄ?8$SתXX8BSmt^H%!eDAۚ㽠@}y<+V~;v8%ʿNA/{GZc뺟(Q(H` `q8Nc;W챱{Ofbm,yO_dwZZbCѢ8L1i܈~_CjVgw19zWl0lkwC.)ݓ1|ٰ̳i.,q Zuc0؞*+0BzuomJPDZcovT@Tr_{б>2WP$t= LշI$=:1 ^ye&@'e&Էv9$.mBS`g} .Ȥ)"ee+*L1a$ p@Ԥ`|ȁݴ&-2$+!g t>ц _mD$?-$? АS* kB~.,%R1K=hUd6[y}} OR% y]}ئB,HJMu0 > 9\35׮56qthwlӥV dJazK.z*sIAy)YF[~UDY3;pI ʩU>7ss`jz 4swM[?}u"  0d;r=L~a}H+y*hv(JmDʰTR:L*N)x2()*^jn 0o@R<$n4A=_zI>vC>m}Iwl>s^02=PТp1B@=6a?UM~կjkYX!SCQRB6qY,^ ] Ǔ$!t/kZYI f}݊ʁ١ 0a L$Ϣq!K؁s1të`WHvI.lq]juIó?<,Rq$G{vwKX"'_tQ~FKSiV.+KV_ \z=zP1ju*'z^N-߹ggG7Gz8!o\Ie?lEnugVE m04+Oq{U IZ L0#A;/q Ur~~,q_(ԵR?} {E|q历Z7lBK{Pu\Z󾝅cW W~|љ/mǵo2]ėȂ>I]oSOSt`[nO6*ØXis^,.W,B]2O>>E{aHԏ->JV$@D`!$%"g~o7;6Ρ]>iõ`|OO'ڲCj2itUO{)?'pf>?+57'HY8R'ݠld7K(xкl_K4΍Ou8e !XT'}n$i)*6h?l 2ƍV  v[R2jYϮBS.I![Q)C-f"L&+뾒1fD=Q~_!22 t RdWi\CClPOQ>e?4?񲆷Uc!<\}B "@ aa\X?dh}yGcČAm=4270YG*1Q&[޷G6?qj8B/E{>kI+&Vp.R5xj{@񹵘g@ .jv=ӤIXcAOr*|3&_E}' 68:OB_ % Xˤ Dvf]tKYZavk ?BB:Ȍ2=#)F9rvT"(#&m&1ur ""PURErU+?C}^=grvj:HDn`wDp\_!FHkΌ}b6Y*A9u3t2Q$?izYY "#::H8S'X2z3;n;^cot{4~oy {_Ydabp Obᯡ5Qo+:6kZhJ=yGvw9Ao+3>o.jwaSCkWvn7NV_J`<14C%WkHIfngC{&P(A@OԐ4*Y[%B RBZ$R $ f'al$K=@ @ ) j;i Hd`H,BlH0$ @dAd.)5\j_ՋUVkj6k[>a?]Ced YH@ʄ$I$ (CCQ%>?dd2BJd O@32j}=@$&BCa'l|&CZy$d!"BH$fI0c!cgy ƀo:(3` WS}bNMݧ{d>Uԁl fjNlyAũ] ОYYh0HӨCvkw`h¯սl5;D} pj1-Y`SIezbuu@B OAWP/.#ґh"9;sc{R˒" *W=۪nks|Mjs M7s^7N9vOۯwMz2\pwG{z&AHwӛl]qds9O77z^nqcGV`c[і׺\ !hO~0ah_T]$B..?5$-*IpIO>VOHROd0d?zhͼ/Ѡ@lQI"HCC!E HI$P$1`$1I!/r$[U|ZUmo- hّdKV浫yVZזڼ[ $z I (H[&,X<&8^D 5Q .C*Bj$!4гT&!R@ag,Ax0 Dٶ*ׯivp(x]OQ-W2ͫ:vTV)^Y+_m? ib+3!3No?z5yZb: 凑Eszk!ycaЊC@Q"xľh7?J蚖x(N֔ ŻG|n+T8<.k YHAGF$lG5diڻ p|Hbٹs w{/C-/O ٽ4//5Yj4ۊnjM軱TG{/SgWJtA)6rѨ\:ߏ[.3mǰiQA_0sʍ1&Aف*$hN1XZ˂X ]$ᙰwTBBcGyy_ᨘ`?_>7bH{U_uJ޲I&l*Od3rCtE8̇ 6t*ߍY,.JE6uX^ֽ`z@&JVGʨ3%05 f Dv*$]!{ nP&}K{Jg>Fl'~yc&zC')_03gH, oW`EsAQIB s 'NR =z9ƋX%?A'.h͎|}x =/e uuKOqfQ~rv$Iծ][62(nWU/Qqz.R5+MU?+53idE{..RZiI00O-'9l\}-UN{#2 */^ݞ6 o\a>}_w,H^ Ȳ8o3At&dl>?]D}}fsOq4-ov( /tݾɅ2y]ifS]!$lדҾROvT>K~SV,aw >N0HOs6{goQ )!b  C2c͈,'M$DYUA$/f$9MaHKd X[^J0ilG+jC}NS>&T>5 L8QR$F. -lPh3^'k.:Z5Fo|eebرf^;cՂN.W5o=ǟg0<ΠܱDԐnQsM0L*jN9 O856=àe7Ɵq_ZW(lЧNTJOmV1瑋49R;yZfwq~i}{}za $3&!>vJMr-Y-iLǺ0.P&&$L&W*C8-'S\FkB,Ҁ;f[޳(AthRl3{|Xw88NR#vQaq1̰Y}3{/x@&D@@D"@f7k, 2p욅]Fd0 DU~anns,CdwwwOb~{ެ&?\2-x_tަ>$s-{wKjޥ~p]i%xp]t8/1_pe0.WOhIp'vHy@}K3;WR$=֝Ąm:dB) -8TLIa!"ˠ2@FH]/hyF^$ @be d!L ?lOvtsg/jipT~鳷ڮ3!'V.eEuʸkvWP8%P>'7e7)+tY.r,VK_6^4 $P;Ywe%XZ51*oeBmN]?QCڲqqX^ :J3wxvnf3L\o(%i/h8b>^W>*}nONGc|nH{]䶓Z rMO;/3cVsȮ8MvN;cIԗ;yw->0)y;Ŗo]t]CGW ݌wYᘯ8^^ḧ4!)@"2#KMR "Ek~ܗmll&+.ǿӻ%Mfhl$gzyƓ/Vm{?o5қ F77Ûԯ]n?wH y~<~wkcrA# Wƒ4( ֕4ālX{ {״4?QlUOd ԉl;ur$P>U#S;gz7}vadkce벽!Wۆ圮mdWW\WfiP&sv 7YmY-5w'Ͷ)PjYֻ|+^Pߚ(L1;'K=I2H4=W=dvle3aI0Z,\32K@WrccUN$( %e4L kݾtR!+'T:w/0hҹpo e.h=ke~EåZn8ܖH .%Cl>qnec'ݶr}O1EkfJ^zNor= ̵K!!SZnH@wܮ^$Лcs3a =k70VI>`)%0IBcv&DgD`]s4!VB?@` L!0N$%]H!+$Ft2/{|TR߫Ȳ;<־˺({.E5]ՌzfEv41ep7Fq0/Ԙ~v͙X6U4쌟G߸Nb!>rvz9i*;~e>^^;1k$]pOta<3êF&AMq5;vT/K7ԕTqj^):)sxlK|=zZ*x'I^/ղ eP)g}V%_qXm$+O(P](r\nt+\mfX3&KWUdK։h,4f8IFE%Ɣ@숄@>*b/;brw^{ox~?ߙEF(E"$4 7s0]F;t;ݦdӟ5.n_4\V7Ѹk|] C{׫a0z(Ner6E ϝ~]s=ڵd(<v9-v*Fٯb'Rejwbq%&,ŵ=qEB"M)(~/V@Pn6X4/XMRyf~[W_]nee\ZRnf/@X窪[(oʺ)Fv ]KF-~3LV.W% i :t\,34ģ` ňeQe@,gZP`M2pac*,fOGo֋Jɉ:D5+QBZAqc+-t?o]RQ0Uu}x_*s۷G+ޤ~x{&4ˆ^Usf9F+ye*!"BKMءT\Mѕ:\EE?rc<.w|>ۧ1N.My&zMcBVU/\_TԨ8&Є2nRђZp?:uyӹn{q-֘aSb]Sǩ9ѢİхW]|P!tm9iqHw]aN|o[TKNj st=S}lK6l§bV gQU~˭hzEx[s%clGaZ&U=7,BdMT2j3`Ǒtd&2ώzk;5MdPOj㚨(PFak&C.[);ɒW~rg.]sOUǫ W CiJL泌Wr +6fa\,kk TPMn'3,awV+YbROV~c)/NtWNy/۔p6Uy9Zg%OdВ0L)(dP I*e 94?A^G%[#т( (  'GN8++>\'8e)w\EK#@A(#} v=sߦeSYwXm/$NI~Kgm'0IcXӊ1F-x kjГ YY<2}^pоt *ǚ&T&}L1Sa,V= KEp:{\#^ }bh ˤKgI Ӌ, ֹ5u8&@lHB+f Sj'U&:a2mo͞6{2 ]B\&(^++]Zjx{PayRkqK Q;Ҿ%MBbpG1<3Y<ìETĦ^-aԕc.g U:5O -͇IDx{cF>2̃4i4%S* R X51zt5"27(TF +[/-W@$Ƙ~{>#_y03@1~I^T&\?KDg*s̑S꺄~nfi޷I!I^RkE͖RnR;JdĠ:2L a~"J(N`S9dʶXK]b[.a IȒtSikege`P]ܜĦ.C9qS %{-NInRqea~#%֏4a]ϝ*ubdyM/`̥Cԅ1m6ᴯpto Qq<\jOZ[ _5({bB o>z}hE<0iأfY*1CtC;Y_iD bfKMДId~\`LBsvdDG=y-_ɀ~ʊzb!嵄^IbKo,%Y:% A!VOkڼB3`:`vbq5@`)E\__=k-JP % ˯|^tK. @ Pmm"T*IX ?8!}( Rcʃgt2)3oɲh=2(G\rxbySl үpй, Ka?l9H\@,,:9kexbd/^\+< hz:?-2(¿^}sڤzӊ-|^bEM;mGΦ׆u0Y'oJ iՓ|Ea>tU̯wsŧv(@3q`Ϣ8YOOsy"b̐$1S:wQt:S+k왠H[I)<7WKv||R!XSF&Wu&qxF*UVv|v}T=MY2 BcBPxF}|25SQkw3\o_B@Ffk26DTzE[(U>ף G>2|{?"_ t(zk&}r}<+vL~\C'k`L2C΄&kS? SR-ٵ_`p.I$+WưY\NwUI=`HHS &s&MJN _Gڀr}eU7%8P 4@At^#Y/kŮcn[2{(waiNx_t띞_aڡ{"~NvJSu)]l9KfƢU\}pͺXثsX(]W(Qh,U!I%)}OsM[w^b~oh_l+3]XbA{~^~u/PMW?}+'@ǺG;ۚy kU(MR!XO}|f;?`3]`@Ł,1OaL.=E@.zfhw5*0I˜dC @!vT dqR_2eK!j28$bi K3 fI Y;$0>$3dBqL`نJd0Hy?U'!x4zPu昍Dx.[5vAHCp(zi=]kY^t5>O)^ezg$i"=^N W6S֮3G5ɷ[- `$q s?༯_t'r.U_uiq|,g擽OK70SAݡK]/#_|vBVX4EDSAh~?k泇H D@(B  -],lQXPH6 B ׻|ݍv-i{lMYt՟nsW5>whQ}lY,k@jצ=cf-j]g]7C7 ,V)V2ߧ&_m]|V&d$0=u6- TP],0!z((W@23  DD/ ʀ( Х1HC(IҡƂM/^e5PRIm?{N[<),$Ś*Mߩu3vSRjn=[~n.)7 nohsop~҈m}]E* 9x6/N~@ܻ] 즷HzuߘHgag2 g}z$pHP(DQ#"==?˘0WXNyg+G-*)׻&׫{@8H#kwb`3As~Ւߋ+wѸpᬹo%5ltT-=g43tm R }3+CKmP'DC^rHRSH@,,S \ V}ʝ$Z=j:VH _a( T{ޮF՞wwnkRHZ~ZHcT(urQt$ q7./@1>6}{g3G'A}c L6*iy Y}of&i7y) ViAXU$!L1YsU<}f>xb2Ҡ<ӝR)/rT̗rG$nq%8 N^Ϸ;~_<}-H\ @b׬oQJRx1@}aפrk;Sl @_K-+g?m]#VzU׊Ũ?.=Nƫ~=+W?%3jٛ^6#`$uǽh9\oMK&3RP,di$8&0 ^Dxzuw /F[(JEa iAlN=6_@}&iiթ'rY$,% ?0Ww1lF0lIY0"*13,@ ˇ!Ib NTVje"RDڰ٠_ e\O$H\5Y48 !gV#͛YZ+FƯj?ڹyMr@4e4쾶s[jC.sfl/ƚH|!@/a_tBe=]?785,6g_¬^y˺B=k!b0CbeF9>U3VN,V+OtWL!;zw/wF^Nz _D6XETmMArbWˮkg7Q޺ڌK"忈/wי뾥u8lGi|^\ї &^]_|=S#x߿.'guPFNUK. h 9b n7I}(;0@R4P±)䷺D:{ⴄooc_0Mڠ{:%T \}=Ƥ >S?VBj?i1= nfiJW=UE [[$JOڍT{ΗcRtgS<[@  1}07"B!BS'bmuɻE'QxsYԗTnu@SӞ?RfS^ġr-RP,!1c&31%ʨ@p*B]4~Ouߛs~O[(@z9gwel/s;;Maσ^~_Vxk+E!v|n^7|\A [^~3xZϜۊh+*by7ϳT?'1 >o $hk$.ent-E֠ !o̭ qpI  ! a^=>%L-{ O.pּ ~;֨<-KOrQ(+$-D@ +U孝ˉXLO-=ļc1OiXޟ[?,*v/gO/Um}MR"BcyF?`"YV\3Ǜ$0D.]*yqa1ز-.A Tq5ٽ4T|J&MwS;wK_svo6=Xv> 7鎃i^őTC$ @i*38M9M egILҶvPW1n@a RCŀt72؍ ֳ$=K\ܭC^oiGۭWl`ͶO7Nryo/vOGMxۻ+ M_\< tA1p$w<QV^diᶀL!p45Ԉ዆df?]9I"bP! &iP",mRI -[K?Ze D 9@߽JkEWKV@ ҷ!:];xL>%zEjˬȎLS˙Of. w%aVWxϒaM%z-/[^Mv K q@JP19^h}D ?ewsc]gőu<IC 5{o\撢EuDSn"*#QܾmyʘkNa+"Yժ@%DOcq@%{{Z.F#M1H@ncD % #Qڮ#F \⍖|#"ŐL .+R5Of~伟?s}֯V";=x*.p8HGe&g>uBE8-;3")V@bH‚ OFӚg;1tj9&U;wLa[H_Q'gnk=cr]}=aYźx@ @8v8D@I PL Ɣ@"lzh'PI?MgUWZOu*e$] Ɣi{JvdB 1,!NZ@!!O*uSH}V ~yaiCWb֒gٵmz~W>yא'ۡBuwL~sNxuG+dlj 5 K:!pbQ+ fN\vE&9[<☉Cc[E=ǢErw_9\N>fRJP;OXǾRQ;w['Cg2!p:p[gs^~.cf֠ܞ_+6w'@+@q2k{޴rӶ U`VJ)@d@Dv`d0JKֲb {; WOg>lR$]'[hDsz?1ѥT[skeFT,ކ ߶D=U%jP}'qI +$`1^q XD=(A| `JjyW_sJW!>kqJM4t9(:sR.HqWў0TL!^ߏ\X!O-~[XXXr39 Z  *֚M$$1c)ZL{ym4<4Jo݌6 ͛EmUOZ0"אbIlX?Xy 6Jzެ-F>}z<9LvwA+`;H6)y@Hn:5޳ L-nhnD(:#-7~Ge\-  "BYyG+5R c ƒөo穯HA5,|H!H4,*Ol.REgbTd|4 __PnRćڣ I $(%-RBEu Il^t _,0Hzck{W1 <,HD`k1cZU\G svQۭlE+Ġ2CzSBE'Ja>%/|ϒ*:X%&%$=6Tۖp4hτ)'L tU'kI(iWGiw֣K~ 5}md=*}Nv[iSkdn˙4kWQ+y~m6~ V5 3}YefڬeO< ͎uq6"$W0@! OE_BBfYv{\7 QFc`[ZXEE /Cs7>u[ڳ[əyY]S|jbp#6}{;+askt}_;<$M+o?ke/ znX~1! &Mzoض,Hgۡ2|N{$O=SP.OhG\$~/YP!-j8J.O^Q?SVʒTq @ϐgٗl,@_/ubCskX9waǯբ8g ~>[va??Р@x3O"*ޱqGXQPNfs!@Ԍrbpa|ux>I"FeB2Fd jA_>7QFubhG͢kn[ޛ.TGéV>?3 );uܭfa}s4njjqE`z9n⇷tcJܦGD.+mry-;YWͿɣυhx^-eֻ1wJO=I푩))NvYU?m}Ox=,ajԔ^̦g&:JdBtX'WL`G\)Ev/mO1þY31js+|OǛXd~\/J~,&=1y5/ߝ 0>J#l!DRˡ=缞})/} VC$vCN64@׶ xXt i|{1nqP-! k${#А.פW?r_(r`ʈ$(o{\ !lX-+gy>'z ڗ$9|?.>kX_{XO“[8O~}LY&XXOCOwQ (0߼$?D\bRL}Ū> ͮ,`;bP֖ 0 qYB׭gQņWUn~ҊCepთ2]tJYtb%>YeLMGƳlPkіpgM{mIOIQ?fq??7ZlN3 {@̀GqFW8JQEuLGg#<Fy%fFi)lM+<#znM~gRXiDA?EjRC UoZ~'wBaG_D4BKXRYޮ[ˡH ["RȠXRw֊a9tAb搡ICyHX߯ 믵)_.kZ ^ؘwn[$F҇a5?>^MwIړw8IUp{ҖLl&PH A h9i42j0"I.D! \LaTFyI$!$h9C/ʘzi0qNBbyN}!jz(z!PV4d;!$7-ƉžOpG զ.Xϣӡ?= p-:÷:8uR+JϸT*z0A˿)gy5j#A{)Fwm?w( m >L?ّt2IfL}] Jia}<,t<&P`K; xh] g{S) JraFVKe!nl %AL" $ʘ h .ӠM@F2+Kmq\s{PNCVw8z[M)w(Dō ? 7> +}:$5utp6n$ Bi$*ԅ6T/-/>6! W؄oZ@m]D_X MZyd4=6=y`< /E ٘֙-d34JΡ8kBZ_\Zj'*B2O jlލ SNaPІ@05){h1_51Np01 ʜdc"BLeܨg-^<UQZ̩[[ĥNrbc1I/.s"_a`N"fG(LJ ,/1"[rj.kTHI&05&H"ٮF []X1, >S{3"*0^dEHnE_, #röFM6Y8ݦmP"!`fɱ4͍ SQH <0֠6 r^^p`gԂϱC҅Fr,Qs8"F;(bu0lE"0hO|ي'] 1"C#LgH2! TͅMNH}T2`DF$FEĿ:xQ+;~{yt5Y-hQQ\dv/5}\]Qs=;˪6LҢ媎H4#~͸'_9"f A=\B=5*Q?Ѣņ^5zXcn})c/PR9;GWVv׽Jx4vk U,GĞʏ +o̵J+e\Er1?Y?Ïwӹ;Sgj|V#OAiҹ'ߤy B iswxc8yV]Ypj.yB!WڑEA;^szᶮ,teߪ5wd-tF=of_Tsz ^TSeEU=(̚D#ɲqol~73谔1HGABR3e""`߹ OtmgU-F[=Ѵl7Q܆>GףKM#p.QڎcIx_Jb8xcT̯1m{0|謹떷Cr%:9O _UL+ܙ\#o'?y+%<fqI~>I.IN}' WZ%&n2U?z6-]|=)ّ۫tDN+$V]_NN:]7)YBw|=CSn;(!OhYfX8P r#n2V[wK_u)5|mO諾~dcQ[/.|Oן*ӌ9p~B^;]aDl9ic`Nko3~4{m!/S͓ >|jiäJDdsg!$ĈG3m@@oN[ Bt>l|?.Q +@֛sۙd0n={G b5z}կ\#dQzc+]V06J>fQ'kmioK sv}mwDD".}3'AsLFEBPe2_/PbJ|^]IoADH1)F(&4^z|,Qz Ш0ɝ\=Oa@$̻zD;#o2bJD)Gltf+&w5Áɉ$F0@s -Bĝ8|uLѢ%;$d2@Д3Ag3>v{ZbN< :yS/=2,YȂ`XF_swO-<ѣ:F גaIjKATND,4yR&n(~bq^Qݫ]HrzjQv髷#?Lšy+ n&=Q" 9˼RY_w:RCFpnzR\s`IW7Wr>/1:Y_nȾixcs*QkPcH~l2}or{fI_Z7NOx\6]CG" ֵ:T Y6(NAI6|ϊF;)7xfş+:-qKJȲ_}So+%9nݑRÖXr*yo[k<!LJϧ+7&Q,HWcu׶h  }tr~ulYЀQ 4*4r3.wnk{fNu`*9FuB'0S6*WJNx։ vG;39VYA<̅QFcբ5+.ƟȮz6Q"LBm/hȫ^-qN9"o i8_ nP~b Snr UIjލ3hx{|9icԨԺ5WR][&󽅦w8)ґNjyd.cQ i;( ֙b)򮵑 5{~i^)`D+we'y bo. i]_JS0h_"Oӊd&nzF36p-2I>K; bot򒾜;00k.sV5rژa )[`#UF'M?}iNNj_gN,ƴޏ}/ŃkK9:C>Yè>w6NrF?8` CA#wf;[7Pgˇ;gX8T$k-bFi#ʈ'  -FPbAcNT]GK!¿Be0@b伶%Y,S V,)m<,tNID2I0.t~8H*lـ2 ܁0ARKd%Jj1Iޡf ^*֪2,4\h~vjh^Ք`E$C!KxgC" Hɀ#m{ڼ/*{\yIR !D1]S\ [Em$=l>7D}շB硆}ۏ..cz/VY˛#Ad txr޿|_~U'}+tEE@o5qqۨ)@N>1a-_QH PW Eb-1֍[mrƲlky͵}?hO"kJr"_!'pN>} |Xp Ha8R(0{WY_Y__[3U#Z=G 9|B=yïJ+hR*F-7) Pؐ튾$Q@,@0l]j<;\WdWTغbQa9 &UETΏ?ԛ@L *#E5 $O:;m43(dJ ;=oZZSR!( >s4OVVL.S!R7Mslaഛ/N̤n:0^ Q a0XV[9SCGuWV_Ph2\ׯ9sm[Z}ms>LV O6[4h(u]TXKIIB ") QH(Zۏy{Zw_\/FT%>A>)F,H%Oj!d"vm_hNog X!ttN~6}6/ζ={ Ua;ZV}FNy@)yTWh@i o5Ukwt`Oa*rw!r@ؤ2}CŽ!Izj?J),pBIz3֨Loi`zB &>6fVDw:ԅ2ZŒv9 { 7ۻ_y -֤-o]*1o pVK&@ůVGR[;5z҈"NikQ&&{e l!9Tq̲/Wߩj?_+ѷ^c)E~Ti=ҰcF2_YeV{{>@K 7G52޷j3jȤ=3L D&?r0I=cϥf۱<~^ }Qȳ>t+ BRxkt6ٿatvf?'dr oWB3,µ6:W‘ " u.\/^VקFԜIm8x޾λ^c?c3s5]Q  =q3wN\A*;m19߳ ؅H#ʏv9ðM#`(j1 _Z)YbYJD 1.K%*Xw8iE~  1 J󼓘3oP[ZzKxftqaPbI-y @Sއ.[^;}NSj%xqV<WNhs?^/Vq+ <_/Y#*[|:N! kmU0n{G Tz yc̻py7|$MT0B$c+GW5l}Z: P&pHBmw-B.Th@ [u&8Dr#C{8wB*r4bN%D.D$HfgY&cm;qbB]1BАD&;pdnGn)1&,āyG&Sv;T `C`5~>_~Stb)x ;(+k?nKb5D4oƥL:8[c~Dy۬̓ܶw2vq*' O0AXHiV%U̇~CnX*[0y=g=U: ϗ k:-%܈1WAѤLȯukz 䜕W1}}V֝#$VPA'1-xW}<|%Ւʚyxv>&۴l%17VjyU^%ftK~׿iwn\;:GY6ڶa=F}|4Za&ynZ!1!03U. C׿U_/LP'eOOeHc!ppJC]22?N?O J?뙹yIszS˥$Y0J L$GOy~m@1.ΕeWi٣{ԐyVG}~"(|զ)Ao AA<>fcrJ!p RGUb@ɝ/j p j+rH3XKV:0ʩ$z$  .n$淌=_X1p0/;cy_+5hzJl?ՓwW.YLx/}8?-`ԵURS0^e P8=]ƏMJ Tvȡ+R11AW3[I^{LB"&Xr\~3vT =g'(kti'1A;B;=bxݞWIPs%,P3r׿98̺j$JvV0T;'^;N{y-#r@z\[fTw>-= Vӡ>Fnq6rsxjX/fd^a|} ͸܃Wy&n/. n(֏Vݸ\O`B,lmC4"ɾ9D0*JX "s.ڝE4, j96.!f(/' NFEks ek|}BC]ç6QJxMQg]=~shz}*,>=A^{ͣ.|"AC)+(1t@Fb,RoP"xexW4^oH*$w dH`TL%x-R8~~0*LViT ύml;eLm-k9'm4~VXCtSrB /ĄZGH"Ia!@D (T4J-zv[ۆ>z%ըdB S RK0 2j~M|&d1d))f!C5ѬR"XS Ge̙i||q}H,2߇p:?k=5b#i=d$fRPF^[cC3JiWQXcc5RAвdhr4.bvG2"S&B,W\}~vlHA G+v2L;6D@'pO@$y6) /S-|@1@R)jŬfӍ2z …ѵM\`i@6aOs& 2?Fh-xE ([[czk"A`6j'L2Ă*P6`0ԴeAE1b "^(" wkuuf(fdEܹؖ/D%MP] WH(z$%Ypl R(Jh'DL'SؙgwzL-ȟ~_%*w`cyhfu"q5Ek 﫩 D; O Z߿2췛myɐR1׮(fC0)Tse!zC$d B 6 x|2T nx>--`E{K2Vil0V6rlP1>=  #,ݬQf8R&%U"^1R)J`` Z@޼̅XY;'4iJRr?j}<Tikmfu `iڋs%'hܒ۞O;-l :pKfC $  o ~m+kȲ5}>+v .se)+S% (9yJ/oyk~qNEV ]F,VShщMWfJ1(?>]]"3Z?yϜښ"ty{xq ]O/ ^۲ԉˢ \WMT4ZMHF}Y"E3 DiC[2OHmf98*QƳfV%rKo5{iH7|Xϡdhݴ{,2}i/Bkd*LBT@j64: X-^IV!UV\:vΗdfm̻%'nBQ|$K=_W$[5)Z@תpb>!;JH\ rh@3p8s\ɹO+Fns`ڕ{rzڛG&4w~_  9 NϿcx!Vn ᳤dli #[(;$ RX=mXsELc8I=z&j2ppR"| v9u. J%mj{ $<},Z;,A((% ]SӔ[ȟ֚J =NB7*d(2`{ MvǴZOfPpZ T;uw9u{`,@ vfp΢;`eGSAHXiwxo&khz'Y6u`RDJ4/\FudE/Bx{E 6kBWRLjpofV8!Y.U٩Q WojԴ̮dHB$173WllHvF+RXrsCqg//~["@_{~`>y0[9pl jp{;{ yor`PVK@ %J gڲ`Me<mMVBf7Ƭ%niOw|^!j5C͆NnZ t8$_kfr@Vަ(LXMax>eDJJka e*a\H l.ȅ8=zpS/KTJdž у@c7PnGdMRd$>_T q €TXdՎ815J/Grڦټ(×?met jC>WRPYm0GĈP=Ju-c) y/5nC1w7۳_p~Nt3X<3L d`JEy3)5 RGG3Z{ A> ⨢މd^ 7)9芪2).:YIPf_kXaADy=y0`j+p&Qw4*D[4tkҫq?,;aC6oњK0pmj5n!‹<Ͷ=uG,ge^Os~2'f6N_D oШ&8gN= lh3pl=2UJ0ڶnkid>X!r)J!zw#P= gD1Hنh_Tu9y tȼu´gsDݳG 9$K]okp<;%.[G(PQ|A5OHXd@ƚS@Og7#H,JDhߒ劍E[rw[fƼ3[g JHx:t wƎ~WnD众}Ӹ(+PKMFNz2E u`]  VąԀ{nBf o0$r=ӅFs$zpՎT)Wsڽ`TVb%^ CxcjJ `O⽪ʯf?O޳k5/bsB(Ԣ}ɆՌ6 Lk̂׵J4Y J$o]&Qr,ĝG 65px%s$ (/mL="ÐjAX! Ͷʤs0|x=Cܶzݗ=KD/~&vuaz <3|v8_-sC+9՚W\(O<so7V71 +V&M0/N Y-9RC@Ij)|,,  w}vO}ms'|5|Cu sY =(~sG+&~ p@`|D[CXz-$?.*,1A]0+Xz!M?{ClЀX3B5G"n%B\xhA/]Tk 3TC(.)6ziBWEOG7S:D )`4 Qg>snTRaU /_CRgU\Jȳ/U~_B!=}f7Lc}UX7qob͉: Xh 2pe a֚E?.Yd5P 2 EIng`H`:EY}=]\8Hmj .L_Wɲ,7['Wi;tKv^h&X{Tw; jS+,]Pf~J/' Zmp`QCmSD (i12c8<1av~pDU9UE oÎ~}K~ }A$N7rKBtÏLO6:kG@1)3'lP}eeGj{.'ë )Yw?YIhq$ " `.MM T9܌Q?3)[}۩-Yd'B7޹1_+ʱpJHO.%6`fB4t^LmWL꡿Œo}?ԻDO^}01إK[M؃¯qW;yx}* jcfWT HG}[+Sz>lW.Og~F.-RnmZ3m AnzR.8n6pDS мsڙЕ*f=EcdbW1"`mOz ZNΤJ*>xwYhi!ޙY. YsCI1`NO6uRl),|:TDAbSRD('W+-gHniV40HD%otP9 6SQ넸^mk EFȢ8 fg8BDEi*H烳Cjd<|hwh(I e~|ʊ)e1u UYPڻ?ǚnR̩ݓ0=3SGm\ًK7RԝJmng VŷZiDʱQ 78,ԲQ UtoG;qa?';qO,#Wen@ﱳ?%w#=Ӣacf(5>odnrz +u%R']N"M~5-s/vF b"RC6)<1kby?|xg=5ʪN'ne~P4E^0)s_h۔c)eUET31 }ݿ>Wg  !̳`HWkq:u=fFq|_m{?Єd ԩߔ`v_E@98Ir XIhDy"f M @ʀ>MaJ@4|i&$yMˑ~Yɞu., ;s \\..}YātYzY>5KfʔXgu@P~5rntWO?΢o-h>=Xbx2ϴ P1=s&VW%:.m4YK`D)/%)ĥ*OO/OkBZ?ZtY.}p  zh6 R'SXˁn^>Qqk[Ǽx%n˱q { CYܝf|>7l6L -e<@^](-{uaE=~WU P(4м\+r!E tGyL'CsXX:>k~d1`?Fe 3|wm _0a4&Q$)\?kJF݄; % ċ]~?,>:OV&(X3&H)@A1FЮ }@jln+{ZbiYO2n@XJ؅.q }YR@/u .F@p1[($-SORdZ7 8雛 K,CARޮo[.KYuztm3eL!1 lK ̙Zcnt['ARDW',uTZO(20 [&b@2u4^Npxd C sx@`"Rh/ ._w՞SOԁv(s[maV\F/SMp)&}m~D ]"1喙//؎`Q,aY5eɏC!6Ō<:BY)l22An?iRmmf?:[9]a?JV/ți~)N-$q~  WH=;36w)ceY f1%dj[`SAIvRRzbu(8&ӤAʕs0;+1ny}"+0P9\vh92 jj'h|÷DYJG眶 $dR.\ᰠ{pZyg]Qy)\xz-4XZZP^y_\Z<~;.ݕI->[3?4.2<]S^pN1R0֋R}%(ۢ?#d- 1?y։VaHgXEjFĆh[>T~Z CBʃ ef cBei$ͪԖ\eeb\HP-j8)* dPTjqFl*jI&'8J'Atܽ2B E9Q.[8=~r[f5BOT5gtɋ竽*_ٓP#f*~I.J1Ѹi/'=.5u~0uHZ,3 !si3c:x\{LyJKw('Pl@2zY+(/ %]=c,Sn RQEDA0@ TJ.6dlSN^l05nUd":+T3/B s6K4Q Èk } [ j&N7sbB_fn0?p"3$T @(Yb8:* )! @cdh%"y :]fWq;e!zuMx TUǩoTkxhe7c27Ua,smR%[7!O([1} ;ʓgK,v?6 K<*iQIqK(%!"q/')F7MF՜;\Y:#Q(0X' xl:.lk] ԩ?QyJbUjR(Y0vY՛RB˱7ȅ Uq>ܚ 8=>  3(bB6@]~]]YТeL?Ozכ(m S.'ɚP.#<,x'Ҽ;(kw4-wZ"f1NaC*d"l9ltk&v`-A=G߉-xz76c%y:cFfr3mϝ'm'kLu-k PNqmE? 0C1׊y}Mş%| 22D -yu\9rNV*'g*Ql[f8u?`H|Yұ0PԝNF}|&x($WȚS! J<2* r|Jwo$rADrbl)sjjq'(YE'D3obd7QM>SJWv\liO*w=Q6t4\0ܿsi%mcH$Ԣʨ QYO❯= 94kH9 pb$%c+sv׭ta4WNM0xQ{a0d"?hŇ~ظxw]v Oݟ#pKW߸}JFF}ykB,* ϼ3 i~fd,>>Rhj`NyDm;Oo6OS(xHbz+鼶9gBQӆ8&l]4_AjxU;͆DQwvy͎57ܿ}row:~Vמr%(Z髕5TkKQ:_M#I!) z>60cˑGcy֑?x#㙽sf qE$9*C_T?#?>6I 'BF aeRIE|m/kayfeo}c<@G;ߺ˪TI2:ڊ!dUSCij^ u|eEMVข5]BKwaPsc(ctU j=jo@ V$Fէ3O{~o|lKWq;!a ^7MV=ooj@+J 1` ׌W\G ﻻ潣D \B.(?E'uYTUbDjZ4YΔؑǑ1ni:;I`S?6dž+o]Nh漼\}hΫH\i'"aYP?r/2(E ,4~?w=d_Wڪ&PT@9o+ ,bt&K.>4HBر)vC c)Hbtc+%5RV@l6ӡmi~ȀmZO"ywg?8c3 `M"+H,#T$#z3̀rL,UzQJе%>ZyQWa£:隙Pqֈ6=F5곔ҜZ,+PՓe3t?P̰}m,}7}݌P@D" Q r4=uTXLE\Q D@(t=e·H+ijo4(!?z]?I3ԯy3Y Z-@y .#Q}x__{yu}q +TwI@,]X BP*20 '!&g%BU畳K0$=S 佘78&:ݘklӼň&!Rs]<,Bx0fy4 ŏ$5hPH#<? 얾Z::2-}YGD[$`jl)!Kд_RLJz-9q~wHK6&l0?E?3XC!?[. =p S/S'1/fֳ ꭫ܘִpqb=aChהI7Bl̻k* R( aYq;b9}[8ucŐrϻ'Yc0r ӘF@a*9xQq^-7? )@s|{=SHɌQe$/߼'wt@t߿MPkv*gR^;4!v j۟|#$4H(G BEȢ{LƑ" ʺNQ`ZAr`~̀QC1e%Ptor#K$!ǽ_c! d:gIjV~wQ$fDL3ә}%S@YEH.^@0Է!M-.0 aO$|i4)ԽFIapp4FKғej}ht& 28$Ct$ƑC3o])WQ:2V,D&^`8Y?}׋t :GJ"\ l=G}mlBݳbe"٤c[Xv;OHq9eY~F#$8# ,ܲR( Y@8j=Ο9Kř3e\˭q&^],S,lFuQf<R1>XcM:% D1}+?AA~* Pұw`(J  YBNM( C4#ssӦgr" @{-e^Xk~^qc/[t?fm]Jb}R7*3I`>f ~=T~e\?;xV:.8ol _%[[7=7#IWq X|4q;/eZTIX?Gk0Wd88:ycbޚ!@yأK8hړe~߲_*L.ƝngH,85EWڡ-( |5uGݗן$W8y>"PfZ`6P|VP2b47+t +?D 6 m 6 x|CZ ^-U pL<CF %5Sq};-R1e;={׉\YƯiϾJ!HzJp.KAȥZ5 3,db6!XW:;^랠GMwHc*#ؼfQ,Lhߴ&) 2b5E{@,iHA?+Ou;#:`!NV0Nd& VBw{#bC&W:Yhv7euq(--SMxFj{z)s. x,_'-ӃgnQ  nhbB ߣ#Ok*09_DF7er LLjL ƠU(DAbLb'w[T}?{yNnPgl@}~?|S 5)/<ќaiOfU|^gWH*B: ^r.;ߦ%?eU3K F%UkHjꮳi ' ,La@J7PbД!}6H| $ :lbM(~v1+^,zZ cA͔@e*l^*{ &1P )S2"* g'9 15~R܊d"L5uPG}ÆZл w&L;5BBa 3kfJ"pP ha(:ږ1MkD6< M)^5UB"ۉM(0B5:h!Ol(bhA@-T?!cbASLN)?wPҖST'FyOnMGa;1|d݌/3[^zh|5?x );cJCQ|)tMQtM&(w=ƃ=oW3Y@] ĺM'?1tl.S,=H U?"\vß%KlbWu<Z2li!N5Ou3)%()`z <7: +nq6m5q5Bjƭ;֗QE`I t%jYFm祭6=gdC?|S!&e0̅R~ssPxʝ9-0=t;fGb_;e#LE>2 HdPd:PTTRvDJ'Gz+\H#7'ueS 3&D3-vMKcQh:WS%os0FMO/}6f>b&D2e$["roՖד9xsN6v75?_kou?`6煾YZ$>YP+P_Pm=t$Q{0Ԧ޽IO9%Z2:PiDm$d>vD*%\-Y/ +Ja ļIM ` :Tܫ&>|\+>GYe0F*P8Bڊ(ZKT +"TR^䵈'JaFd(Q*LX/ԽnR V"|QQ6|Uǿq&[[ys˸yIٵ99km֊Mhm!Bt cݟ^^b"A6P 4wPn|~`ꮜUo9Qtp1D(UDpqtJRP_ri[߯,9]n4y#!CeCDk6hG),Ule)kX+ ^ kUJ sL)EH?(b"HR,Т:ƥLSPD(ZY-*L`( rf\2j@ !2ȔQB (,,ַz*%>mުS"%CV"n>>KK":U {. sSSR`($$V_)ueEG( YBnHCC-߲ʐDdF4dڂG℈^#0{3^o٫ڶf#ҔF6B i#rq0'@#1Z~0k0Q)Fá\ q6 ϭ@$ R-Ei4go"A/1&h}l\ve [UtR=!JdN蚆ma0*X^Ʉ*GZfYCjP}[p}[|L'㨓1o diU<Åjps!Ӏ3**nmCb?\}UzNEwMJ| 2#str2ۗ~`|t1^%^>}obff+w,n\_ݠ?l8X@Js "Ԁ0vPL}`vf@yHi%6mSMh!+Jbv53h(Twg?^U׀$#PVc ξLh BLI܆>{~8|lwN<{~߄W(eɰs: HiLU?m O2=6 ?pˣpN_bGp\1$4DHF_ #V`-B!FUY X:?>Ť`Hag3?_M`DcSyP!n~jRd*wu~{mt,F~nTȪ-rD1J0b0`k DR,׻Ms-\.cﳺPty/Mp& ! ^3AEk3~Q2;ڕ:HYm<4zVLS E5 P,Z?*Qc3A³3Н$]?(cbcEe. Ig\Ą4Tq[ݼ~iftE5^1TEoD|>|fbb3fbF3R(.Ηrf1xv{^5cKIpDi Wgur  9 s:'Ed  ,S]ŒH꿹߰_ M?|]9yp|$w2/KO&t~W+ժH(nkh_i_rũ~W_;CkvZZ+ʿG#RDE5Q|ךI6֍UGuۙEQ4&kW.lЪ}:*.F-Ou$-)+FNtUr3cVw\4mSLUt/LWsY[9EG2bMwv R6&w\WwDkFb0rjd&2FIdj v?;{õ`G*EHP4wv݂leMAIz$MLU?rmwm`㹷(LuΫdD%(Jk,* 6ߋܠӌ)e/v Qmr(ş;%"ŔU`'˲rf7z_XE)i $@`34A\\L{_B^c({Yn>|9F$H(-  X%>M HC%70ook;é?%[ye*{_eIשm_97+c_4s%bAANƕ)v9[2Og (CU|%Zs~6- }wSct;wt$ XtK$ ۯum-XXF\0qpp- oOF>^ξzվo]KqSˣhmwu b鯧T%|mss%O >{RF%RV5lj7lXbHyɵ˛fb #k˲4cw]#Rn\鯹DUW"oړi5EyRɍrRlZMk\4Qbhب܊iQ}]Y.-߄1”七c{9v~7}_e3jlQiʸ(,Va\FFhDU$T]$e&ʉ0HBF +S7J,3.EI#P- 1DFR½d6=ҰPsʻ7zCĪ]* {s~ ,}gcFEi Թ%'T] P(@1fciUb:(V9KK_Ŧ61wwYPz|90RgI"ςȬVTFq6#C&{KKXj:L (8KO|lOE\ߩ]+<>:J "b^Vob(!D-(Gnp<2XE,U5P+kż@{#~-;'>慃=]xX De+XXĹV:{=se?350L ~eg,҅4qUf{WV:0nc~O9s-x][?{t3]PLYp?T Ct.>=z1u*B@q"Blgߞg@pR*Oϒl ֗n[ 0^m7n-8 }e?UǿK IşZe޶LDl"4t$.)<As> `Ch=!+ե=fcU`^,މHiNa6 /BAs;bBqd*Ygj8ammBBLSқ |5=K-y]:?55xjoz jCt{Z"Woyb"vqf g@nc r0C4_!,, CٛI-kVʓBv3>}#L#f}^Cst8 :_c˴QSS_ Zy=Y]!81 sX#36֐O9VGWM wn$*?b$hpJHs9y8e}}U-~ iHJ ȹ4ujV~ x^r_(J^#,D7X#¾cra}HRG^/z0,sc9Rƽ/i;B&^\=4V`0ud,e|[y_5q{_7o%r9E ww©櫓YLzʛO*oW{)'_IQ(iC )zײX (s#YhrzgN^oIP)K/^l@?4 a!.UJeCsxt=|t,uFM*͵%KZ㑩>^4bQQS(6o&=괓zHfG@ ^MΤV)Z%LH ROIEaW B$.2PD12]0MNJHC__/ޙAKJh'Wy7Jh sMeA:]ߤ3@F*QRs0ؠfjƃP/4ؒ~VNju%XEFvs_)q)WG#*w] [6tg@ÓjX 2aJء^,,?g,X8,3GypM&eb\Ŗ-\d@V_5YwNF[5n_~eMK&>C&9 "EH %5o~+KwS[@i0)F@S"jWԙW?I&StVo_!<5۪}!ގ$:o@z9҉\l/lk`Jv@1frI„ @D`]’(ȦKj_0|Lݾf+یp7+`;Vy屼<ܚީ5:sU}[QK'L/2UmCdݦ~sT*qg7@3cFv NTv7d5@Ix\Riʉ(v13{* 8H  0 '``^z%Y*C6nǻM`oxTƒ j腋48Z3r)zr`)T6^U 6%րk&P Zr0b"&&,=˖`k.qVR\l nVRؾeȉNvjC $Xvƭ:PZC -i)Cx$ *iXTQ \ѡ@%Le>D tխ~.鐟[{mBp D'RVM[o5bl?3w/-0Iy|uѐOtӬ f !c]J&-WڥK"?DܤzWH:귩GlYnvUZE:60R)Yxy@-"$%IH2fȵ+#:sPY'PKk' vNIKVJ2kZM88I(g5Gxӱ NX&9J*=u-vkAx Em,6催uᾙ]q[dk46)G72[F'Lw%1,iF7pP[ Dٖ՚alI{-L)Lګ_xTIQԒ9/< %rI 7@m3 ݛsA[%mӋ9$7v`ܶmړC $;1FU5쪀f&}ymVtT{LW V5*e5"DK:ys='c /֫iZ)\퉎r &9t˸ya-;=F@e<à^M|HY^=QhلsWPNK$Wq*/F2pY"pȊkeUo`f_*i(ھ o~I6C ';Lar - @4#Xt+,ќdc<(uKG"d|2j@nJj+Ss0OXɷAAu, E)XU2Hm&;uvɛ괾8?Ksz,^m\1IBN0HaL ܢYyϏUe,*ϡ@C>?FwޛP"$Y(yULZ rN:(&[%#B+WD0&G0\y_̔n [JQ  %TҔ b:_~a&@6ZE`]eqivgee!-qmj=c;!?ј1e1&4 ɿa7z))Xl&`I$8E`,UvndE' 0!HQ_=9Gƛm!d4vJkD٬N`;\Mq]Cǻ T^M=}?s":^Fn>V|I<.g"=>bvp,թ*}ĉ@@8{31 {ACUaw0]\UpTLNZbq"(`iYYLlE<ɶY@/Weqy~7J !{l(41@6ךQ38b/ݾ£ _Cmaհ{z>i[@]&f93+؁+H |jx''j]yoowG1J*-)bGEsBV1r=zwuE"҈6)y @f ֠9Nz8_Tb$/~3mXQ'y^o󊢁:dHRđ]ǿp\  ˏoR$Eu0G/oDR̿L4ٶ0-,*P%\~0CL 쑁Rٗ铔֞w{-囩]ҧ[a*5JcɠlO)9{f]K1T ;|fxSUgx.;m,,(al $ m5 @vH+r0HJ)صd(ZנP ?7$n'V7fkeC`f7Kʁ[U;{ZO&HfU30me%^QX|rJZBct މr>VN"l8^qTb8r,rQ`]S?zևga="s1xo.I0FegCwJt$.qM?Bw+ &4O&HgM;]/s CATh9i ~ ώgYJszmq_.O=#~K=6ݞ*N"x+4),ip+HL4;ɖ'&`3`JWi29>v&$cla^lݩ1꾷(9ڥ1dϖBfuJTOC 8~oL b.ʑPBK@3~ 9<-ʥ>gnjWa`F>gpN[!Avv6;Ֆ}.vx|CfQ _0\ uޱ+] h:ê?tq|7H) h- jF(35 ƟfQxQ@ݩ__.Y+-vxMN2^$MќbvL7UDl㚩pщ.>Mhզu:?ϑ8 uhR)&W>>bu\|Wv.Ji z5tm)ff5&bj Pڝ_*^{m~~ ꇱOpNzf6<[^AQQ>?Mڕ7OHVK%5na iK~*V֭Sv0y3hGLV57ՙ!gINi1n}L}##Cq`}H|u^j,bC vg:Ejtf3[y$r+e?F΢^7/E1g Fى Ɣ%ǝWy{ݙ6%aۏ)H4P ")  B1񄓛N" C̡kbg%I#n`y/3ebI6MDB !A?+x X?fbBrKct(6I7c?CR[o1{#HP_x1#},6' MEd;Bpog*xYbDYN>Tfw&S4'2UX +}oz/u_1kc 6 V)1j tk+(W^ǚ B"Ͻ @ǟ.`j'`F}EÉ Y0;P̦Xއ}p0{[~_5 B@@\mz./]6*0 XB)@WeYsJέwSl2 >G j.%g2l`94Эg Q4Ԗ90aB\96Mi4DMȐeI@%RD78a@Z~=(00Wb<܈*bwvogz`I@B/H 0$-@1>cH,/g<}M aP107NnyƲԞ]lx+lS2D_3d"0hi_,N3J7p+#tu_3~Dԇtx($ c!r:ƨAYz_s 0#|_Q"<C/'m/@1DYS$%1*fpŽsEYrTgЈ 9o//g(0tAC񏼲O* 'P|SS>,q061^ym$Cm(2aNggґNdn=xhJ^ hfru!핶La~1|v1vz\OISIX .}Yms8yVRcl|uWf^xIU?(ǟz+co&wbDq2@ ќBZ[n!71Z_4O}w~G\^[lO'x魊F*B:2fmF/ƔRa<&A`g]yFp%^{,\k4/4"0Ggd(kA2'HT6iEpdnXMC1yӫ% ~%; ">1'ksZuz،Nf.yYJ aD& 3kjU_֡ |_ lUD KOvɟ2>oq+. {b9prE}N]\4ъ(SLUb`\M$"yZi3mtlvͻwRrL:On pD I~= (~ Ah1"`'L/xUP(iWyYP<| G Mg#9D%{y{ei0 c4h@(H |wMn$=|(lVÎeg;-ՁHS c˼ٿNUea[UDi\"kS]LzX6z$w-2s,U#W܎/Pѳ~1"܁3|E;5a~2J;b*]LdO:.v1Ȏ Cq? e<C9?|aq};bWzdJq]qҥfsR;,dz\Yţ[Ua c@{[E\ۘ|0`E=-"+ @i nj7g)6w.:ny}{aRvs]efr9J(N,[z)pB uz1{ L<,o ޷}k&e5brO'>mo^zU\љ0`,&dU, qi " (:>:G(0w5*Cw%PZBfl 7\fpogO?zy4sM xSϏtH|4{uľ ;-]Ur?91c6%/(Rmf="@DXJ`hB EICP~.@P`AGN`CJ*υu=O5uY ޕ͚ P~ w˙a<IWgیz[s11:J1-QM^Ȧ)**\W@NϢ9V\yT֤k6EBcj=Yfkg)M+kC vЌ暐P泖'B{;MҐ6̔7Dy%Fp zqY NO4~'^4C]$!KZM=0`i,{;5r4<})βbpZn_HÒHKot]{=ĕx} hJl]"a_$N2P0&LݔҺ1? 5g$OF@/{Vp_w~%a.BW1 HaKi-|'y|ٱ`fl3[ )ExҌ٫k#Cm-4[iO!^#{G>K1l@KT[2’*0+uVWS +` ~3aW.? J3ɖ+G,ܡ JpQ%s*4(^LJـҀ+_̗<<&^^6CZJ;A734WIa+m@@ ;wnEڷz,Wҧcl*AUx?z._8sX@}!`Ș*B4N)b}*Kespb "6Lٰ^hdO |=lpJ6.yç\W_j'wnu"z0v5ZNuVAX\XhX&a'L3*1㺪 3iΕd p6Z뚼~RAohef6U))Å1 g9ȆEFrP'pAL@ɕeIJ%U27ӊǔ䪊,j,3բI2< X7>,eJkaR;/1 jSnx"i ɦw,Ɉ+%mBfZln. . fLk5~҉_VgFy ZlVZoftEaŔ.;KJZ=:GD=戠(`1Ha(IR@ s j1(({I`k8s41~vcذX:bpONڥt\Mp|vdTv+UxYSY -Zt`#9S1z +U(uHav&h;AD ne0mf Ӄ61G)7tb ,dnE\iH/UpA㆙2gWE'bDf4gjLRx\K^[3l} mKx.э@ࠚDbZl|[mN@1w;^6;_0)27 Tn(6i e0#,͙kt`]ފot2ZL%0WՆK#y~X+Ǝ=xy F/:stC: 9 -.-[Ûv_eG<+2F{38Yiڠd-)֗-.jA}35"N%q߮mZΈA:+ S߻J 3'Tw,NLo.A٧VA RLiJˊ;+,ƌ+^v IƲqq@@1;J# ozz,m̻,D<ɭm^(].q(~=$!,Hsc$j_Ù?ʨ\Lت@ّ3(Q0f("LnaR_͔/_}DRXg*5PXǽ)1W0. RcZ+ 5BŢn[:+h;w n%/&[Wi=6&&b7(N)Z6>NͿ҇'+Iv(AܡO|v;uZtG , 1T v2|;8up$AB s&1$V>c4H:|vf #E k{^^_?מwEr/r}HC#?vckJZ(J!8:b>ؕ0eQn g?^ WtF%25`Y /J2AXGx  K)p 0=QYfR;*MJre"y=pg lBlToǃaTmY43y?b(UT_N\>ƂG>`u@mApeHZ7k!ZmPE^]<)aI|f29X$RUۜz #B!'=ġ".efr.u?ݹ}iLݳE.] UhxS H*Gfk]qZw1+}O֪ҽV{T{AnbYU; Eݣ9oIVu<ڇϊ'%/* jg8/JxS&_lzKҨTHf}w>m쫇o62dcEԓbxGtrRai 8nA3mϥӐSogxc T֘)VQ CRpF ZGM+]Sy ʮ HxZU[-T?^W2}2@y)clwwlTRtּ=|0 8d-0`|Bq'dp:݌ů:yM^l*hγdoah6$x ף$fdf(?|kR=Fw~^ ԂF&Gy o44/@e5To2d6P)E 2~qkQ]OI1w,A0=+1_ߺo °pgsUL&,S#.W pS"90Z.Ѩia1YCu6j{LbpcGMFzGPVG!26j^)8@'K_% L, $DDͪy8,o/d+nǮAz(Djh\8Uwɑ:tC4V~Ԇp!}3cr1F5UNnMx(J(x,躑O *fƽdaqNsthnM ۂaiU`.Iu5Sf[X2ӕE Y h'yϢ|v6;2 9`eӆь#gziL֝36݉$e}Ņ10%^wwڙs얘ϓ.XH,2El~U|F,?N C-XVZt:([הiF(-41-msץ<%褵G#&L[[B_w YVW~j1k/NY9f@m['n !5O5䡫n s{0_u|"H ks!LFoY_{jD| 4@U h;Ԟ<Ƨ~v 2rr>2;-]$a.{LCp(J`4FM2Edp'-kXa-PW*`@Nd# ^Qn#Ð%OO.$'+>+ҥJѫV"բZEFBM<-(a}]}HVRuYqiEujpo\AF)A &\ĒmlE@郪j hݪ-j2oUSnųQJ ̔#TnW jӋeR;nf]a8z"U&[2y%~ŗ ciRs=?% >kRh(`0@oz{owl-CRd&R???IC{z/~izx=ev,RL 5$7ysYoC'Nr,MۣIwR^gdœu|]XoM?BV+WT3Τ΃Ae(n23Fyv)D乼U2狗VϏ5"]2 s.rj0%Yp괦4f*^zt`PVPImStsU 9Ȑ/`ƣ%DHJS,kM;82^y͍<1T%C|kL* pBa\%"&Ck_ 5v(NX'b acM`ϟ^c1ARL^/j[WȂqq`4W{hW54w-NŞeN} n;wYZYA:!Y%f@ֆ5650ζg<HyGuu+P1d_5PPa,b. Gb.c(o{u1OSZ< ${c#y0^bG0 0K]Vjq6}g|E}Wmp/t>uy>z'>]$x8\iK%A$ FQyt;V^O+[,1\m}ZO:R7ݱ{4g4i^5.NF6Pr{ξcALOVn5 6l3Y3N{8)T,ȉW]B4PxJz{TN 7p[31œHWr&g« x<Г15o3itM.&0Z`"%f#{ )pv6Lą&'AG;f0֐údg(3Uc3"D%@6lc{Փ%PΞu׾GJH1^`?rpJnXyYS012iEu+ fK_[(y@Nt*O6jv0[^lo#+[WS[b*6=*(Ẉ\pz*MUKQMK X {} p8Y;0MES S7śR&˸W)AJ沇ѕT AUE!p"IUx8M$,s 6QhqުpKW\p +-/ި%y5 ~<%04os;fek~|١fzU=.e %Ok:L|<]UvM=)41%UUB M dXҚlyөfuPyi=;dR]AϜ%0\t5g]Y.yC2l.F$k(ؘt"FߏœDo4S]bLRNyTu8Y )l{wgoڻDL̤Jb.8`p7s'T AG)x`}9Ui45LOP~LJ3jBXxSn xIwwНh@:l;0|="..p+ÿө0BHE.92rQ Lr<|D%Jiz}}Z4?ِJn%+j(aPљ={j:\e] DQb֠c>6J؃c@:1Y$65QE&Q=;.Z)ŗWkE #hl j\%skv(M4*e3*CІU{gBk[xO )ƱnSmॎbPD@UeӼob>0CƭwN, ~gJJؾ[]`H֨d0%8cE1=a$OmxKBF@C*.~+`vw*֜2=5_T6>pஐKU*9X% %K{*ܴ ְ#s|WXQQ,,fYqe!1c),DqF3kEnL8]l%YEp-pD!m0k$tYf l铰YsTaMI]m^ JѤ6I[܅Bfȵvˮ'ZSaX|tMSʸLՂkI9lSE%+"hA@ܴmNzN_:XEXGކ&GNZPlb82SR/ ̨mliZFْ-;5O0UEH-By &i319,bAOksfݥX b!e+'4`X$g0q5# l,W(5l$sirS$^)}HSpL"Fjdlѱrc*7 )/V ۫J銬+p=TT'_4%7ߧTBg-6Hp~DVDSаU8 >G;٢}lQ49r^KvLRaBf,l#XdyS1^s&utx'+J+ X[4GL``{֜hb46S礲<һi RڭMFXo*X'sFMBn9J`o4QRi"!"WxktjZiړDGU}b%1_[ k*$ѓH:nYXӫ)}qœLl]55v%Ubt`d[]S[}lX[SiEcda[5Y2N:0Xͬ0+i֍8,Z=K“p8nALIELZ>g. Y4 ;Adg}m0V6GiqZ)`N\0(P %bTBbϛ<': ϟ2UQef3rbVRx1PEPW4Z`) 2<֕59#G5#7Mװ=`z7UR+|;{ ͆RTю#`[\T(Ac% Ak-\,OVdc_k!`9f39VYv,툭U-4g) pqFYU2p}cIqwQtsK[ьI֬-bBׇ1vA*\XU]S OyI0’"K&km74͘=j\kbrRLs*#B"ansց'sA)-0pS1 ( x00HAVft W}8H͢. xbØSfchC2&ETPb]ϑ2q2$E0! '٭7#U4zT-+CqA$˜D !H %P M %zr& (uɹmԶ3N% Vha010}Nbi-$K"/+-'kٿn9")>aʐ- )qc((( y7}#GqjV?8dnsU~zo+j +ɺ=r@,?-mlE\@/9@j!VlL`q5|Ed:BiC7:?V.j[0Lhjp,F BX{JLvG 鶉v )M7{9q ,XJ9QVIzH @pܻdZe4$}K˝RUp82ڠv}u$㢗y*"J8:h)BѶ}(&8* fj8c{OSSx~ H/OJ "SM v| ?8dnP0+azNpT ܓb;t78 p*&{Y r,ʕ>)GDKN4tԙ$-{ݛfxZ;BC>GNwVNZ2DcZ֦IDb^\LjÇ[pN_mYH$"VPPn݆ ]ݡ LR;n;y}Fx~0(Wy*IPEIh1&3C8'P\pgU}ZFo3Q -nj?׵P=QS3S'^ pE;>}Dɬo+%VMtlExL MA7 >%iYuMkL>(K&r\U1O5 *6*U <֘2"vfVq|!^4|5 (0DSjblOjǼ蔙]9]O?*10'{E9N^&}(7b_& !?A>ֈ5: Gn|{ժnCʹv?q}o'[T; >OŒw2_q" a2 ~㥝>VnRpiL Yv1.TJl=*O_iP~ɖr"9zW;*N; Z1wK.`|{cg.O_KM{Oj1У1#^=uz'm{`1BWP8d kT#1(5=3RO7fOgw~WnQ/Qw@q#LĽ)ߏFcRAiP:|?7@i/AJ0  rt~1wc0 D}Eט_9 5vW .$RM2k[{N##V9$"U qϴLNBhqOވC=a:l(%$ `́?jdG &M# : ÏU 2!1 HޞdLbۇ;3<ژe {m+1yUul?sP\SՑJ \BM_wˬkc~b_L"^w l38nD?>p#PBBa!:"2G dX o{V7J4=(i)5`kz-J^-sayYVO⼧7`{E[ ȧ%P5 W`MY0X솼m ao'Jb_nL)Wwe~=hZ'kWwٟgcanUIف`JoN+}mǬm] a6Lu\0 K̖r+'vՃ;_۞=@ *HKi]JMMi6j2f_\:%~kcGB r64J:Cd)3e~'AZ2c:sOw5WˍKrmS4˥7}yXtKVcțؙe:ϲD&-o̞hnF6No'hV'"vf'TkpzS_5NO)SJUslPg/tU.U!U*-zM/aZL߰k75(,]OgY'py(7o7؈KjhVȊ9!MugbuX)Ij ޶.B]Rc7Ўj>&ftEX3I@o =CVr&䅖zI7:C%2J%ϓsX7idQv'_܉37;P)P? SNmgOɭ2-q; +4:,7NR`JI %WM$ZG^?ȿw/Z֧=n%1bɝg]q&ܻ}drۧC&=5IC95 n0:aTT,\ j4`8Jl3&w.n+Iw[ iELrP]!2־plvZ?>5)58|V~Lh\۞ݫ '/ \M*gJ?#}K zXL؄N ]tlS1&;3"@ 2MGSFFP&2l4w \Vu(dXhu\ve&'W:P W̍ؾoGşB҇ZS04,&x{EwzAǯ;8)Iկ^4K0ӥ۟...tO",;#(DU-[A9y/I4^nM&vG>Az'ys'W:i,dotmbr?_3ջp4}AM5JJpZ[NijTƯ2^M`-cJ9T?dEB²\-06? [`) zc5RRs+7ϥ,8傦ܵ}̌+o Or[N.f)L ?Ma!x󰛼 階K?հ Y"* $f+6$KpӬ7{t.Ic*El9SeY|iLPlTnj:,ދ3. NnWZDɲ}n4~2LOfN7DRQʊ3x(> lP+M\)Zm2Y9B`I|.>¹ZV3 rO //wK$KmƩw$O_i -Sph@%áb(մ6Y!ȯ1@鷩fGB~[7$?R8Ygïqu1QQCe¿3vcS_dҡ7)*a/fCLgYe_H!K^=-MmMjFj+]c8_B(L)JSe&f(C.ʂBoSs2{\Ig\HeӤ!CP]f+eZХ[weQY ?rn4PiQly˻*DhQ[vF.Br'SgLev '7,yWK2>}9In, r}эEd0$WJCpE ""Dj 2E*D"1̘iϙckZl8Q4niK^ځT*t~mjzW2x%7 hT)kbE&mN|-f'U%( E d_tWuœMzO+I=n8q5Ujxb mSs,r9/B""JPaDA\L@;IT 3gCeX+V<#uWSSu(,g@!X@CS fW7eXQPLߗV?\gI>4=YzIjxەz-\1u"0>M|r:*htןԗ'tm'%=yw}k{3{u_{]iݽh'}{=c}S!9Rzmo/c ӫ9pvM֝h!/ L3cʗMj,-~ikkrIԥov;% VҌ5Te+sDZW$)k2W|$xTt/VJ Q!59gw]rxFfK+KU;Yyc0߆E5 Y},}Ϳ7Z+($I6/UXz7GwQ5̌dFѨԖB޺A]uׯvs[*`HeQ3.Rw M\W26 `$#RCjJ0nG4d"]uHSeD#T%$K w-3131?N޼Jeι[}_zc2.0#o ]C$QN];4)6LK@M0k?cܲj& PnK|,F&#/zR29F_͂~SNՍ|><;:ve[`5wx{]`knyS` . p f];Cҽ- ܲRN(8L@\ݺe.5(R2$pI(R`JqK]N .ܔ#t&*L//֞ @J|K輺?QAseS01Cf$0nuRNm#Hpy$!qfIuySE|bA!YC?u5jR)A4 RxŚmؤcWqU<1&!v\][Nfd:3wA_۔Z\-=T_ BR?Pw{X_~Aݚ:[iYde$\R)<}ߚ3DC+YfZX51A^Whn|:3kܵ;P qoWhoKh6O W~[A+4aמm24%7C<1(~EƧ/S?kZ+U\&&d؟*aP(8wC^F$ @h+GkPP6Ԇ A  bD"dcPW<Z+x^?K>[t;DBl רK+K?C/ {+p"9پiǤ嶀]_F{68ћ--+ՠb?מ!f~ 0MZO t{3 ͿzI7_kxM?+8 l%DjКYmQn5~Ykt)zkLeD2+>Q,<DeYg+(-(x\+~{sw5j5S޾@;Cvn+4R~]wxEHmcwM kL2 KG#V:y>SgA^ E;ql"Bk8@Sn_*R!=3K A:PՎXYyEv|'4Y-綆X!^E7Σp%t<5gKj{BW}5횭s-,w7\q˻vtFw۸fИ`Yy ڱam_SЄ򼣛>Nd?g־WZzZJl9qp_(d ŧ̍LCtӈs\-DtyR>|&p y̵;J9in.9 VN^6r1r%iS7{b CWO\+˾k9 6~mr;[Gb}y'!or7{Ӫ-IU+) (/%W,ԋENw]I',QloiO8L!30"c0XkfxUs5=l FN 3MH h$`;41AWXb6Ak}ti{ YO#2ϚwL>UP:e'go1(^v7'4W&"U SdY.i=OMlOP?y~Jd < Mј73]3AhRhN V̻PQp}M=>?a/0ږ"*3ccJ`kd;-^2, 6QƩ&)(ɴ&6|,Y3Mb2JRa-2Ơ,fB*$6SI%FP0uf* $4AR&ъ0d &nN$IT̆d2rA!zdY!U)yyM}9kq=#1:_ws &X ߋbVd_9F\_wV ~KK~|/I{,4.>3"_s"SNobBYr{k:'ߙ_&[`8\.{%s,7$6?Mo}yk I0Z;-;#a47(#(O1:4+))ok7̳Yta;kF$ l2cSgd9WKJ~7r=o7#痟% >(OPP#tK9u.B$i׷J,̝X+Y&1TOoSB ;F}̜cD{[{qkb$^'W^]Uc6W/kSǛ&bY-#d\\fa~|]ݔ9;(60`?5rMqxʟ5 <8{|Y<1 |LP<҃8/7=eJO|@YO}q6?wğYk+ ~KYr.:B4C~/H#-:C1s<'dJYFxI X8w4i$K%43󤲗aD|>@],0`}A$Qt~jSrgynV#WtOO辛g;UEjjO[Lb 򽜼RRέ,yTX_P1瘹P/ZCd;g$wOJz1Cħ"=U6+J40>C^pFH $Iq׻sߒeRM.9v_L=l0Ǎ2wM̍ C·Oȁ0:N/k+--<ԉ'L7&DQt(K>΋t>u^{jj_{(0HUM]VttsOoT/Us߿luunXZI6sAPa,f/~ nF@:?>Jc{AC:E]Ews|;o>>e]B};)_n;IHHa@.(6H֘ ;SF6 M(dR0bQz(@DDF8(KNU&g@tZ Ϋ1xA>Vg*Sv7k&]ްvzf!Ϯx| v2]kB̛vl2Ot-(! Rg4j4OHԋZJ4[q~^3+'ɍR>"Lˣjr,#А֖fj1&~RI0 VT ZR[5K1cZuqK)=鏈I:Eu$. |'}j渨K]tfB?ՖtgҚ1j Z%o|PO$?N fn1C^ 7LnJ||Nޯ~_T SW"lF<\k -J.ѹ)UDԧf)licj+yKǹꦐ;wg.-xH$| ld0}F]=Ef}-XU!]5VȑmY%ijG.̾BU,jV z~=Tꩵkw)4-B<u];s正Ge//nz\ekEzG 8|}JUzb[t |" yDuК)1rI-~7_U`l'7w큉軟뱋,9x{Nȋ)?%\tsM&XNMND(-iY831i?[M&*[l3etx&bLc1R\J_fN6 lq bѻd{v_ښO[,$[wnd+jͥ2[XfM>lώk; -9ΤD+%+.'?TQI bΔpުSj?';!]صo)gs- bSIgkVT_lx %ȭ~ǒ| 1"dАjbyBm8s t yvS7]9Jn/gG!q/}ҭRl0STM:PZÍNcCU=wy(x`|~^>w,2x\Ԧ'x-ZJAG-/Yp(`^ysP+ KFФයT{K'MV63{&g!cLDwVWɌϪ * l!3|@ !3=kZ0؅ƪL;,!`_wxǒxY|V6U]3A`bws5:X48oT_o[!:̯u|{fFyy]CU㿍Lݹ783<*^m9Bkb3dV5ng2GoίNyc}~L-6Yٻ9nՏlWު')+] r2|Ѿ""~fS?#N+=@ط&)B%7^dvsCDD%#{^AF0{vJw~|󩶊جhwkW6-&, `S R8EjE"Ld(LQ2&")5[-4.$:r$$BdHL D$ ?H=rnc7C. A?V4Q>}gބ+% >N1㻿1i@QI.Z"M2ZS_ :[ʙM=̈́$m.z$W% -˒90?vm=sʧotkS ˆ9L$|imaY0[Xb$٦dt[cG]&ďwÝӷnB^+TS.s~.- TyETvQӚxAIF='TRNW=,;0Lepd,0ZӠ Xh(.~h=_n7tx!X7?,RFgχ0]of/P$m 74Y, -YKJߠ>R O¤" Ē'p@ٱN *޲Ĺo3v9 Ks?ÈuwԹ?2Kyӿ!OUV)d51e%srT)&s`j\}C-?k^Oi)rXz; Ġm9^f[ǃ&Ν9ʟY 4tt|"K)O6O ŹƝ56h (VkD-B2BRc`6dI72#_t03B!(c+{g9jz1WZSmUFrn\&1s&‰9ϡ! AoϬW_l?hO!xRbDT0GJV^ź[:?nv]|hw?UJPQS8U$),P:p W_Ϊ{}8V<c)h:m[ ^y6Y4ͷ<H"5Q}II4S:qe":;* 4 eL*tRg"[; A}ܯsXXacl뎗qjO8*$ ^㝆sXЊNM;b TW/"/Bt4 nh炿 }̘|T^rD7{]MMj1֖4%{.y[Ǒ^dOu I (gF"Ar̳&+uk8v*A?p#D` gLh -o;_`9Iz2؃ LJQ}wپ G`}BpϽ?TQk#⹩9ZssqvXX 4KBϣ3/cf6RVCoISCh6T#ʲ+//62H_#NPoGgvb;-bIcsUu<Gߓ$3W\ȣoy?cY `ǝyt.OKٿVeT&{ >j[fP:t}ӚF-P0L҅G|bU;f]>>y3s__ (b}蜤B|fg{Un| z]6+6w`ܘcBN5hm-Z.V6Ơs' 4B0xKqmȽ9ɑGڰL͈W9sr;5pO]C;έ誾WbWGf D@Gv덊 E7u*cBc4^66EB|$ŐFHa-wwv]*ն\ѭGJUAVCZ=FA&c=u}s/m:,sN[8~1M71<˛ FPl1d@ym{ٗvowc]"t/Kl$)foWbWb @5f.94MV4N : n˕̻N,ŹΦ"aSS}M ҜH)<8?mFK\u27Ә~g3r IpWu@.ƑGY ̄GC}{{<[4qҽ1dZ#xw` A!=nM'͟o)0(itK?ru S39"'kUw~òm'Sm'Eݐ(/U0?'Cg9 3wo*T̞`4$@jᗦ̋Bk7dhk崴!L!vKZ46U&1 Yx(n^=jX7Bht*W@&?숾)gv;Βw ?(E3 3w, e Œ>OgM?*ƃt>ot MVJq"Iٶ:U0.p"<Cg?KzQ*@E\m/~I9+#h09fL(E5pV|.? ?]鄅 0l(9\at49`;sˊN[ xwM4N>/[7'C1 3Sם{# ;pӪcOipё?(`o}6yE.A xQ \Y'k|𓍩񗬝v圣ߨuB- v_n*䛸{z\?kҗhBv 9K$QRKJ$n YAG'15WY?~w^ l&g̙G/8~{!SW54i@GcdX#ڗ*Gk5$Ewxż}. 3Z ?EbOOzL)j@ p᝚(0(_JpA@Z 8E{ |S'AiR];FP1̦(Ǹ:l$6D`6p&EΛ.0j 6ױHM,>_!?1 #cti|ЇR6 D{fY>86 &sn9*4&m&o+I/Ȳ6n6R֎9"3r7&"Ne[;= E%-|WTp63dVMq@@%w;ξSjXHj&d$!%Ȑ%P_ʦpr8=?uxgw]uČB >frY<6M!F96 ku|;7o= ~p~'{|]*:SiVy4NA4bO)a1>><*WJ_SmK&Up3Q)g^~LBg G0TׯؓLz UV녊.mZS~}]w{Aaz2$9kQ~dUth_Og=Dz9o4n>lufLX?˴@jOԸģU IA9Z`^=8, 3V%@67Ф$lebKQ.T"%-"Ր`QG'Lܤk??1<_Sq2~^&urP.Q8Z8֫'M^roQ33(Y %̻Xw?+6'8hnkŋ ߯ǿmVx3agJVRfR]3wkmP"3\ 9˙m(qm6hي`#4@?<VyZBi6GAiivNmΗM;8<91WӒ%"AjO:9f$[iPa0oT+e7eM+1_fۧx"Yk ÎOMMvG˦FO\kr¤2MX^_v.q}>4eT-<#,a˼yʻmF{[5Ȧ}kMlUHuMQܢtH8O{ƿK,j'@?SZ'a ]kښ *V-0Х'L ƿj9D3jCuy+I'c^o9(Ó]I%%˕1U9~nLŭ'{ϗl5*:SǏE/'Ggz7zO(=C\a?,˃ĔsH܃r> }~wZck%OK!;޴|6+Ǡcͪ3x-u.J`߱De~[آeFN<*/:S~ɟmE=^Rm>bTKiXCSv!Beӄr5~=̇J?ql*iLB\FѤ#6:Td-PԇG!uY<1"hxMzUwF{6Qv~lYY&4fRr3F+vO=1r@/iÍ.jٍHdxMfj9SdӣF:yk֔,FrAc0y)f֑kec7瀯MD<e`7['@:^<22KI d3[tWOf vs|K2ˏFkG7Lғ :{s2k%UKZv@:znP[g,kgƐV Ly8*]-g6ebҒ1@OJ5P9$ &l78|LyL0āiQ! ׬^t~"*YVwpiWz̈XN_Nez!}]=FE;(N+~Bc̻ #2G\Iw,ߩH}t +6k2\r`m $IV-u51B·yAjXe{5B~J{fRkk;ufLzЌ^-\8|S\'tlHH.as7d(VS-o}xw60,V)0$B7#Su\2=rRq4V!,"Kʘ;o;إ9pP8]Yu&,eXs趆ZMs oc*[FSW_6^Yvf_-)V"@z^[SWc`_O/0$7v'&@[)G%jC,Ȁ`-F,cW?MomF?WS _!_`oi&(R+I /oT!7gWXkO erk~]2Jk҉fAT(g&z=H %i@9m4&lmAwX<8"5$jnPb\!:Q·+e7}5o*/5Tǩ-ÖsABwc"㋌$^Qn4 x]%lNFбihSt8yfDkȚai"S3z 昺>jW`c [C@d;tU\7c%ƅ%m64?B 2k[kNjv r-6,nbO}W"QQyzfJ\?XN&0\SƛӝKqtm\/h/;@!(1|(ثWW=vkҘf6V18ʉ')\uHJ5">.;.saK3< QVaf:_6> [a5mP,h G}#Y/YLyzH]C CrY/Q|B1uިg&㌳5YI#1s }uWq +>ce"}p|/ 4@x1N?n{BmR+bGq{:\=WTR.;:>=9 Ȁz\Xh}_崄y ZOq:+ [K3e9|3ϧLi c"ulW;tJ;mLvi3TlhNsjgϠ8T+]%vkG]RS1<>[8=Rp0 RϘv EwWq96o!'iv̎+YnHLaoS0qi,YTmK{˗ft3]ı* otO67\mܮ^ mw3sWGs|_Țc,|Z&TGRcensEYƣ%2Bp-Z^ 9g:19X'HU')LĖcƒB_S*kh\Ȑs#&Z,ҀePA'0az?_C`lh>]lt<4 ڐhݦA)C߉ψQ(I0(E͑DcI [&E1Ą2Rbb&0 c4|TM_=-Q֣[EmfTT,%J`)-ҶJf=laA|$u 'Yy~փ OY,|\S_&_ioؓ, 5 tjBW 7rG̋O-: Ot21CAC+y]Hf D#0b{& L vśI)k1o˛ L71J:|OggY5".S߮x\ɧ'8AhG)Qxn'GKF<]{\eiA{>0y oB`YӓL[-ĶS.VN6g դsonf{#M M=m,,KPSŋYÐ-tRa&k!|>_ƶ'sJېegZ *5_OJzsM&Bʘ*wWZ-ju7VnLO+Kĭ-!K-#GWcCAן)55FUё5-mȷ&Cj+t\JlU+: 4f|DB&T|b܆ED_۞>K/޿HhW<Ǚ##wgIu8i|ݺFNA\ԓ /+93SõAu``/s?l̎5oyO~{$. H^Eӹ1u$f9d`C|i1o3~Q 4H+In_{+9Sg%e e̟"\^vH*.쪦 (Lo7VPe9̣w1r#5rRH#Y LYW9xֹ[EV.۹S^[=z9CD0şeE>3;s;țN}ޅng^b{S`Yf`lU>̧DԡsL:>W{~BŽ-e^O'T 6Nb:[ԃunz6ﱔ?&NxMm4A㭇l`WH}s1玼-/!JTǑ2MiA︷W): evA/[zѨn ?c;Q]b/ N]DʃZ+; 3sM,]GH&?0p_&!ܨiTjorRgCfnۋ9sav?cEⱗn ;Zg|{j+o~GΈ +>_VZIU_%FLgCRD ֍ts(;?+7 o+^RXX8_ONE{]I6 ݭGJp+V͹ F" Wr3#i=,xrz2.R-uO;A9rQJ'f,EIBs4'3-[6h!oNaX&p\wI z.?.^v6bs '[MݾY>:kJ.",ʩٞƾcOї5Vq^;oj}L6H)̨mڪ%9MY}zNOˡmFi}ԥ/E!Ļj*lǛvŮeܧr«1̎^g,2>F|Лi5Wѭ-!yxRV@xRZ|]x#T{KR]C+oUKQ䟘T}!R*d^-UR$k'1w=d}-߾>yZz竺O[Bdг;0e޴X jqFc/=: {i( u;%^od ζ>V.n0M^? . ӫ~Iۺ?oGd._.x :[x:&iUy"BS/zy'ّ_#= A]7iXf+%Q+U)垵i0٘ı[˒)0G0jZof~yQ F5 kC|*Kdh9!FonU2twGZ9=(N1yE?o\-*cE'yδX(*Dn% g]y]oK3dk N׹]}jW)XgE O53bz;r],U$4XUעdUsj |d ]~;yWǿ$Xr [m?gSʃZcH%o0?O|$U"^K+V!z%l3Q Ȼl϶9Fb\|wm`60ƠS|Q"DC@iVWp%Oġ.PyUpK;*ýaGi @!2:u>r߷hͪ4z@te-8i9Dǃ-~1=>K~bȃzumoPRث?yY\("j Uf: e77+ICqJ*9kqL}mbn| ?OW ^S5!oY5dD-TKPԧX?#LU<%i"2g iz6TLN1I*Y1uBʝ+n"\B|HK^ү\ ) N:%_(Hq`e/DƎ#qł2I ɽXTT.:J],'^F|O/-Z}mpe=QťĝԙVnD8sBe Uea7~.>쭐0!>[KrbyKPJ`% #܁w0~hZgN߳>|@yKej%/6M?cxAg$D:dYUECcE9P 5iEܔ_CD@"ᖸ(c9\"L4: ^FQ\M7 Ӛ֞5`t}},N 0^'6f <-Pr:ťRx$=d3+Z;aAaF.m#a'/'">YLtf?fJ< "㙶Tΰ`@I?TX/1M`W88Dž?d}Tdy=ʂ[&Ȉb!W? #SٞdUToҞi|YeѐQcp;};Ԉ&x;d!B `ysF}=S"Sk~]>{o@x- !I3OeFR ]ظYg?RZ, fƙ(gym_Je;(qFe/C(i8NJޫ]­ !(+ bmrm$֊,uUѬV+*TʹV*5EQY-F dLJNb"PFazU- ݬ?o^ZH25~> m{ӹYRP Aj9 B" A@򻾞IlSXԦ,0Y BIVq˲U ŧf誷vN '@6)))*J}x9.U˳EB_gL.Pʡ,?yxVm`I?;p|SRڅ';]|ϧigX! ןk|WԚ~ZIk>R1 zk fWZkD=݄o9 JNZX7QUlT|h?!a!4 q(H(ZBd |zK2- 7o- $JCq2}Ife@@etjp4wV.*%ËE.{rw}>SsEy>G|N0\š-A]_F?j }ۇg-_ mCX!0P- E*$S7j㻸|?A i.*h_?J0hL[,h8@% $ƒ~BUi, Ǖ$:;A]wKlN4@[U*tUsmP¾ԓVTRux#wI+3*51J/-A&&|3[4t8^)2C `Cgn&Y4E`3` V;Ε\M2%=1 9IcH +exm Z=|Xx7j/gFEQM_2V^A =kuv6*ԹaUHyz~44;G,]bmCJbSp8sJ7uk$0Tʊ>v pBŏH04^eص?}jUoٌvYP_| En;qTWL܀fD)/]C֖+u5#L#DORY/biE э8fS^L)Ƙ~QOt"|?6#`t(+q_z}SJ|&Ǘ4 Fԟ9|SQhS(>{x3XnwƇ7YV"`bq!ev#X`w1T[0xAǎR%!r;zM%|1<'Hg!ș*+>ɡGa<|>wOqF'[x*dC|O"xwxDMo̡Jl45YЉ b:vOp_%3SsZg& ف Yqx1c ( 2,#S9/Q6W:S.IYf%LOꮳorT?3?4y *~GZEI z\AZk>BǧӨUy) /:OhY/3 Az̅sq%6LW5~CVbz: Vdu~YԂ{^K o=4 U"llaY+A.O{Z k2A4 v[aF:]-e=5D4nʦsĔR=-gY?) ڨΨ*%k!4jJpSzBgͻ,`׽ߘϑu^t'{pGEiB8qތ.3M#{9w)Lu x.CIOM1H>!aF^vfM0Vk%JTb9j6DZq H^ᕀrL`RF]KȺd13ѱcN~uNݗ娻De^Ф7# dSo;"-'?\hۊ{ѣUȃدOw}9q6 è;cerD.G:Gໝ7[ &I ] ̋WP7lٗ0A mt1'Yv|+?ne5e.<85C9;{8ڢ5<:&B#Sm;LLCZqAiZЀQoaTA+Ž x̬!e>9_sT$(t~gy|Ho=N~\MbP,(a!EdU9C Q 6X`%Ƒs=Og"S]*= ty+ OS)7NY0$!--}>KCg(h?iMnR(Fѝ h5(C) +6ԛ .9:R`ϔ0-.aʯ6ҽk=$ ' `3@`${;RPvqUna+P G EGc/kI@i k9ּ91cz\fJT0L Bv W ːj2 hѼusOVNJ66̶Ñj*EQ.'u;toĆ0|͞f vF=h!=wp*y :1FVVS}{Iy9 JjFqѶmf)'4 IJ8,sfStBZ-C Ã*F=U(M('MLff+y,tw/=9g^s 5ghFZ0,mre62Ê%D\^˵쟑8=kTYhLv1Dd)̦D kJupmkosdʭܗu{L/O^oTb ,cFIL#DI2Ho[%%E(T Q.['!z Jj dM$d i-SAQ$[LP,2M2$J,@0{r.lCY~׍Cu!kUpI UkNr_CAPnnY>{vj~57K}guVƌڡXdkj^+0oonbw}-?!8ZnĬ_NH AItu )WbZU~KIl__)ʛ?ʬ,[L& W0;tL4 D;i ۨi< 2WosXk.kq%qģ"(+,hU`SU96oI$GptcʣhJܭTL1kX 3R森9JM%\iL>[z`oL$K!f0IBf{\Jxl'GKW3YIZAi+i(֕nBi5)W]s4{CN&^죤WA@[/~fG}tVR>Mf~L7%iD}yғAc3 ɢf']ŗJR5~c-9,~er:R'XSveWx+U=ѩVHs9 FΌgDd}:+z8+jD?Bz({vrbP,R:=QVutA4ddN 1C~2N 7 +Nvx4Oy4jօ*2-`(CG1/}qvԾXH!rtv{y L:3k b1YZ:@]@1E*4Qn8ߪv3cbT*Zq, ߖY77u[rNd<^oUЁ^B$%kul_NC̸?8!Z s L*`/d{!ZSTKkjB;&[dL B'-}ȁDh$R^ȼYn$p72p+}`K3XHӸ?N`2 dCv 2\ϳ6^ݦѧȤ/?N.̂ 2:|B(jQ:!;ϯ9leρpu;OuLΉ]\NVeOeosRFX8{4`(L _.ITĪ d# uO&9!fNs OwVkB`-^W+vIuEHhYѫV0kMk#Oˤq Ҭ7W5o#LDLJPGpUjBr(_̽ |5V߳ݧWWkn·{6$\ lycݏqȬX0@K_p%kp͇oo>m.cWr \ a1ip?hILfJ)OOVR&\nL63;E4V1<4<XbfP[JpJ,A6j{oЛ~, #1HD9q8 keV7_$XEW*S/E?'ˡP8?+o -|K18i1?e8[v-(,ԏh5oË`5o {?he[Ҽ(Ov+ ! n 1E7Ica 7mɓ TOE5{r@nj#,y-UϹPk_E9DZ$/??ٱАᗟ3_ͯ[mN-qƚ Ȅ<6v,74eˏ(!Am, Gs ~vx= I<}2d~*( Oҫh}D~zAsֵʎ868={S5ޮoh=>zZm_W sgrˎeE2EAZqnT]IuVy_+)Pe_igaqysɈcs_w5s;'!ÈClR@ ) 3/[6ם_UMiq؃B` -Cd̉i)N _خ y_{y<cnpod"u kb0bRRHF±rɟv1e9 v{n.}-H 4GN@V:7`EU}fUk" _=tA %M?CՌD%!*&otO⃥Iߠmk(K%,j$k¾&?{j]@*su㜈Du!M,ぶ\M]侮8$yׂVjU07y͗ ;ȫZ{z^RYϋGn۽+?ᄐpsVh%"G6CE6[ہ1QA)OJ_ @F]йƃbLf7듛G[D9h5U,(ܠo2?#;Tp^vv5xP)DL0&N.b63ؼAl6= 8h!%}H0E9ͽ0:8@h.LGg+tITHA*@H6: ;FN#Z?~[\^lU*Kax&ܪˎ2Ih0$'>sȓQ8cg",߱H~Co-Yפ7J8d)(&)gwQ /r+{veR#N =!ǚc43wihNYޯ1<_7hSZ^CDqLAF-Px1K'["?-i*'y[~yX*bJݫV~RL2' _W_8?˗L`>6k'JPLAb~7_/m~oH߰^}_aC6|u~miñ~?0$w qA2>t୓3x"1&')evlaS`a] OS}ؿ}̈́_>ϪꙌ]71b7FJmؾ/pi`ƿףQ+Dۍiv^kTWifr>)˿U}s-06\L΂`KJtMu̴ B[>F0Zu./.Ñ E a3h`]V2 D[;8r*vouD<եZ<.}u Rq->e']ɹ]}'%ST9>!;n(7|<B8)8rJ"֊p%?nͫ#,=#һ<^6mXCG<+4PJRjM::](hL50:Hlr U=yK\#u^p26w{""6K^diޭj>-^4\ ёn{1i󫅢u'r Oc7XjM(`tJM:Pk .+! w=0/bRjH#x[fN\ٛfhʺk.M:9̙ʲ谅Bqul+m3}ݜw ' ^Kvnzo W32qx_fiBqg`B89Q6m?ơ-9Ueb,YY( *ʍ %г]I_r&e]w[~YHVPY fZJ]n=nXd~8еU-Ga_U&_vxeW V]jhdV1-~|\/^v;+t0Ŋpr*pޫUn91<ך-?fZÑ\[N5@UѳTC^sg,'5xe>dՖ&K60"\"HE5ڌO w/S_it^u؉gAq@9q-A)$@IϼV1UFJ`첰8ӱw(2`@?lL~f7ZzYFE%;eMMlLGTy\ϭA|%UɆgzA -PqY uj ʕںw邟}wux<<ײBH߸/ڔ#"!=, ȡ,gYٵ)ǟS\_{cbpwd`3w+v2ͬ;F&$( H4&Ka6zm|\Zk+Yմ8rQ.H@S2,IoI_0B ܓ|N!i)tbiۍ%#r.eY'!ـX'ZQdar7]zK}sH"q& ;g{8Mj@~-x͠r&Ggx}D=.y_/~.zXjD .OZ}>O[,E J2 Q4ag9\V Fo[˦JVt9iD(o$LV&AdDtԉ?ʗzѕX+XڷW'uq[L o:Ʀ9SZ#X!0 º%*J qȎ!.?+; zP'I3IeY6 B/#ù" jV_.="%/^q0ƦxSq}^wG{P ď^zL+˒5#Rg) vܛq.{hKg7+ jـyCJQ(OsưlQ>BZ=G1۟5G%hq7FHF_9@$ !V+Y #P t;#оh#.,ɀaS~ 8uV0S oג((2MGtrny,yV@h*7!"5UcS8ݸNyr@S n "x _ s3 䀐Eow7,yu sXݦי`{#Y !Yg<(Z¸YI(X$lD"#)x[WZ*RtP{eAQ` %KHBؕ]T'TЧ@z2 A:` `R&$䬫{`6>[ߴ#ܪǼ-1xNc( ~e-|k1/K%'_l_nk< !*$si<nq]uigm9-fԵ[ a_bTWʵƭAR++㑞僌"[Ć9H"tL@!M.FlrC$jW>NgtY ڦcwkG,o'JRg-"cG+/ ݲRg~@.g"_--77ѐ`2䐆>h5.W'[h`0+ǹ&=wDZ>٣ɧ|a\S2%|:<, hM"2@B`2/19YG0؝w {Uv.}R]7ۯ:kӝ9lMQȿ7 % U@FFJC3V ?fo;<4P\;ow<]xĻބV`M75kXhs^ϚK\m\fF%JZȐA$վ݁cCGХ =D'y ~5`(o˓B u'+r3Tf_` P\ >)X֓%e<#/m Cĥ~X:4Y'ŎKw>%K(|.ETd_ߝy:_7OahngueX_wo7~.4y{g/ xYۻ :Ai(G#E0wT |̄b_[ꎟ2#55RL~b(ٷrPW]ס33>7l~fg j!I9Eܹ++=]Oj:zq؛ƬQjF}EͺzVm?껐o઴RVMµϨ֏,;9ˢ+M~LBim-[ <;|93Zb)Ǹm͏Ѡ˷Z!Ԍd ׁk7-H-l9C#gMnڐh ^rQc ڐ>Q nptBlGgƖO|BV|XuGxZ|I*>*Q ҿ Ӗ(Tc V #* qRf-h~icY)K[¸6~ &x'Rϥ_-],hOhѿ9 tBBSN/Uɾ-ԡrU>tnMr1U%quWy]7S;4- B`$1#ڗ mCCEY4AVK]RNβޏ! i @qכּ۷t /{tI D=)ݥs!+ Gisrzr(+8ڜ%=H&4Y@={Lx[u6$80R{2!,+xS./s~ޣQ Xwgz碩la%r>A^ R{AYeczĸF0[NFgd`.(<{EYsQKEF=/>7|2CjF/%r}sh 8M3T@[9l3`7JsyFSraCյu7'"ڀVhv)^4ڈS/ӌ8LzftIfYԸMj}UGB Ydf,G;> [:a}(L0 " D !r,#Fδx`Hq6551=Ut3((TKoS\]/s pR_Z\d̼d2DFHHk#p+ R6= #\mMZ ĉ T Ґvh!Q Mu]qic54̛읗sڐia~eçAɬ#|/{&+wlՕߗ׋vY޽㈊dq <]33JRa)jgQ,,YՆ:w|bғ*VOم?b?.첣oMONUum#iq7ي i]آ"-*,A}]qDx›,zUJVx8j俛 YĘkCn8cDOIW$Y+(Ƌ+xa(\C5[s~?6cuSՆ VU5UE,t\=?Vl$izyܥKi~I 5IڸTЛ0:%(yӵ1#A鋍N&ZNG :&.Uw׶`FOHfaCI a ¤Մt|p RwBM7ww)1<ݒKQ )}xCz~ujqgt H&q{waȁ@cW}rƳha|z+> `z̞,f9nY1ư9U)3da,^Z^Mmc? CZ z}3=|S&{xqu@jÓaJXA$h?x"ENϻZ0i )':+ g yupR&T'(dIoi~bn}_JDO:̂MM0 #R9`6=Fp ̮@Nˮ~Vi̾w%Q#4,_ DG y) ZBmbû(b,&){a[2x.! Eq(lx>N O)H >3(0Gi([t[w{cXΑ(RLs^CtQ%{F _4P@֚V R)[B)G~f:b+b@0]]谕 VXͷ)("J/=IkJSs,8^q?gw&wl_4^_\DuxxkOqF^W1Xˆ '|]OSM+OY/LA*FV'oЂ "$C)Ƞb4L1L rկŁͦUՖ.O3MK9<=͖6;&b)F)ڷd;JO>'"gj`Hx>*`W.';`BÔK7_a)7%j>X"03"Q&Ai )_.hmZLC6PQy#s^-5 4+CiIQDJ+KPn 3ؘ7AMn烈aQơM<2 8|?jZ mV:f~s;ٯ'ͱpO*ۊ IM٤Mj!gtNΧkBd^3 t9BP"Z)_Z=_Ƥ[D(XRSє_gױ:@''  s }ˇѶuK_Y(sȓByAZuBpMSto /!Z`[rdo%kDwsMZYMQ fW^0pw5ro=C"!e FS~{T!\˺^m  1*0cE"i(Ȉu՗3_߮-ɛ7Kh,g͟9zfOYR(( llyŹy%7IdWAߦ򤈁EFczzZSKձz]&Y-Y?s@︪d7CgzkcQNtrZϯj}5k~8=0.!'O; H<85w0J*>>:]EZUZ<ՆNs$ >76:l䜥PkUY|W:zM/1JWk}*.9[hNtR\y<__FH`H oMSR&}'kׯo{7>Wq'xJcYHOfbD~H W;u.__nfYZ=+ +nluAiIYG~̶bB[Skum)M|=&5 # $w@ X ZY@#8X1gKvQLgh)t&wPS˯dT3!op8g,AMkORw "趙K 8SwCY&boo)0JR.\ wMnG &[:ug跭ѻ?xg ?B2tu?Yόm/[?? D鞚~\*4fՃ1T3܈%e2phqL\ Bm)-OׯWO8&PWH"I>Ttח[\I9ک H'4D`"5j|Zn]Ob/Xb%`Ţ/Gl|ؖjT|橣~Pc;1-R "rvǦ8;'um2,",УY4 4E,4 7QA5]|^{o@Hq Wۛ{l;IܻrYd٤KfsDR!>PQ ѕn7ʷ,̮OƷ~฻]HCjrGJ,*2/KKg]>;MT5#YO~Ҥo~sRʔ`!&u˞I: ^?kANEpt vGow\@aqɚh Ei3KHG9,/Z9:UBqgSJ2c f3~hϤm \O9 3S[rk#'Oejc $hIXXȅSh(ݔ0Rh(t~IA# ti#{3ŠAdte^x=[MlnY0:^6_&O +DtPoӽq#W$Uc)*-#*3"pY?Z\ 8O?=?m1alA4 Đ6'gNXH|7|#)Íɲ/"TjT'Nb IXU \J-:<@Vux49E{tۊloj]H B`{ t:TC]G, Z?(J@.D#Iz-FVf_))}W4 QXiXs$<_Dƫ5l*LTyϗK R$R!BP=nLacu?[Hdt*%6 ż4?mkk?=<!Z]W_Im7A'UD@ |ƽ)$IA[)i0E'oІQqf&?u9-`>nRWXkySJB8U-+&G=[LbG+p[|KOuf^vk^'Ңm{L- ݷ!ZER2iq+27Ͼ\|PZ~͐܁D}*2y^Tj\1E jcw>]mit]I~?Y#b)9,FjNLզs'68ϋI,IufүQ(X d*hkgkvx='G改.f*L/w={7u]FAQ""!y[}^KW4h/}58rhֱ&( T7x\.n֩.MTN$M\Wd"W  ʅK8enwWCx53ib-S;L-=1I +O>\, uR#k]fzß̟E*c"jsN p+Lُ@m+ECCBB&63ȯ} *esw!H$ ~u-'x‘/g{2qAq"X+R"B0UQU"Ymm>ʱ.9wKK~c 2ϲtgXL( n^5_rԢb|q\Q;aLfD3J WC/#rgQ%Rgmc ^{sz %rt(m& tZ|[U- __XtkJn^h79upeKsl^٩= K3T؁8wʖ[}2οX PlDA4v puJfj*xV`ڰQozTƝ4(OmGȱr߷v_yirܸ'7wީ[>>Ӵ~ׂاhM^$ (t꧜:,T@I!D鐎ӂ9, jo#2lHRfW}@aKLA y_Wj#%TaO(Us6/iR 0Dh@REŸPn>Y덯W$L (nYN͛\Ky')]NugY?AA3d\t8և{11 7ӯj59~ȸ2UO3ＵqXWټ7~-ccR(`h9hXX! j%x@!@:u0 v\/u`pUP[Q5OIgrW~V[t O%a&2#IV-X0@!%| tLy?_=62GzTbT+8 DYe+ݴGjcQZyW3͖]s杷2Y4g^/"[aP(HES>S̫h"a>tJхtQ!, E9 '<O_kK7=LҢx/MV/^5R)ޮwx~tuK/3_[3c?]/՚C2c&G'4B29#nE31e@}ܥ}/qdۧ{_VG}{jSD5C䱜u0(\G;>X -Zu3:8oke__߬4f2;k~P@gdUq^3ЏsiP t+%ѷ|!S&dAx6# &xx:Qњ +NPQvɱ@k(7s{,ilBk$;ZSfkT* Tp]HN~γ3]ƭ|DPdh5 `du|\i~E_ g0ӑ'%BQJRCR`bYrӴRjy&kmGoQn|8{Ad/K:.m7²>-uc=C!QkezTn[qȈ/g_=8>lKOZ׵J%3JrϬpI?Whx~S|}?Lݬ1Ȫ] ega|ſ&V%(J^V\Kt(Z.{^~ u}1X[jͪ!18,<-=nnSwOA83dII+I{VdiMe&ڑu>ɞ"Գ$kK}M'}g/]7B Y'sgM)y *5n9X}WdVҮ{GXZf6"Q?Wвd=>]kO%*a5P!77}@PBY&;YNWPrm5`ńjU6ByFySFMܠ0{A&LUw۰#q|r6P`H!V[g4}gEd(Mq}nFi[qnl=f-[0f~R{V<~R_G&B5[}`N %eKQCBC.tr5V.AI8ڕY۔]gg5]5굏 t<G}!|@'kl35,xz;fPn/|B& pA ߪEG}rγˮG(>^G`ZL9 etcξP-R;ybMXWI{rIW^g'76=O"?-?7L~:o(`zMk/&c9.2ZБ@( j}w7d Աm Q1ˤY? &2het Gq"OO$QS>_y ysoQOvc]*CVZ?2XA`]4() |˘f^f~b}?kG.ηޑݤ4-z^eY-nɶSpzyoFD 4po QvJtvIx|4BB^%O6ͭNLiqj BAj6l&wgӞ$D5n.GT(M̽=F%SgZy<isK>/A|߳M t}]wޅRc0HRFz"Mm&ZƊdzj~7RLPys;*YEt\g@9 " Ke\S0*}ڴݘ6S j9Tֽ*/ELn\^gxǙG\}sӡwil"=,(R99x%s4;O,7kU*\=gt]/:}\:R&K2gyuKVRZm߷f4O˪衼JR"vF֛n̽,.`kx>oy8@`F0i&2yB:j;kްX47I} 3^ow:t8iz P I$@e˘~'y,X dϢj徢v_w Qq/2HW\mq`ys]>gVyq0";l} DuCː/ʪYǬfDZh]*V[% #kg ,>X$0 qO9 biXLN e,LͰMX̗N3V8?ߥ';__Ɵ+=j0DT+j 3F ]֕5tklSl8 3 S|TYsDޣ4cHHZ[$IW +WƁF qǥbrkͿkޟsSɽohT"1;RӇIv)wqtS1nǫ!)^z$ eoe /:y @D@D$?`TQBۊS!Dbgy(fksۃya_!F=ep_vV9P3gθ4}#'ϱ?Pbw"S۰=J R 5%-T+JKz`P[K]9q =냛i<8;O3+>х+VrnB8H#W$uzJ 1)4xɬv9_HQݗtPy\C,gpXNc%\yK@QpKhؒx'aGʬ6T$\TÄ Aa^Rn O@Dbƨ_,a, L' -T }<:1f7fMP¼^ݫ˼~z"YoSPٕeN݄x/و2ٳV!>4@[ Dߥ}{^B2%toxA|`&K?3Yܨ ,#2mƙN!l 9Ti\"Z꠪}ޫ}V>zDAddQEDVt cV0Ϯ֨z™cY+ rJǛ[6kLRS UCuJ|W~6uv( F@BZ/&BSkostA?ݯ %3ҸgP[ w>¡rš 1N7 --,F>Ó/Ur|6k6덜qDN3:W@cPs怈X&@)I異\&;mj'|c.BA/^*ۋܩ=1Tȷ)+㰬ݎJ=!?=1j`:+=j7ɞ>QJݗ*cu/?vG)YTHӓ3{f3JR2V?診<L*uZWiw; CBzb M<>HjM9Vߘl=zXU-ju}=dzj^lx/<G %Sl[i(! Sa  @ KBA QBimeݿ"8þb8@"""i[Wn %=>r^(ʘWTi.],FKϢY'v2pڝ!>/^Z{~ٷw/p e B "a#ޤ. }QWЫRmnAPƇC&E̥ị2d'nwj\,x<.5>l-çi/8ؼ.hKaHLHrI)6M Œ}ٙM$„Pj$% !T2[A M`I噗.[k?2xVW#ٹ2Jh}~|EiCjO#CU9bc^BD !I,R&. $hCI'lL[W3*=Fkd5NΗ/ IVLUqxR7ˮ5xhw >/#.sW&eqSL0)K}VOzn-݌OHs2No tA#Yxz)zLn:'$_buNF{`ڱ)xb4kT H̛7}# xOG}BO~.cOYa&:8T癣/?;f~.hʚif.%K$匚zɿ p9BYMڔqLi4QBZ5Z? 9#=w~nn]F Uh|Y-}GM;gԗSP߯;ok>i;]~zZ'|I8&@Fus 90.W _sI"jP009^9!^䍈$w{/9^Lc;捻δ4gX&|lСP~\S3S?d6%T=蒐u8ǸOY¥c/h+?QQ?k r9z!S8pb4JǔP q(4ΙF]@*XȻ/GExJs:\~FV o/;!iw%Ըm?};C;s"yܳGn| گv5M'W m濘jixwGk8tƃ30utQ B D &h+ X5pH_-}wy;2@̮qFWmZV^GrAdfɀX(r Є8 )0{P!CL9H!1 (6% CHĻer /6[d!.sv,32^{8]f~5n}$_v8}偽kdbz{)9\wN/D̮,|j$ΫN?u}?:y; aV!+~0D!%$aҙ $닲rL,X?٨@x@@Dq p):hQ_Ph+gم{:Ɨ=V2Fީ=}>\o?CƉ7RG~4k}=6{dqF-yǂ@"RÎz:<* ӉdfQ(Ц>ss1WfX86<@j50uD!4 Qײיcn% S)6jmyoܤn&V‰A'X.GmC?x|ھ56_ؔpz|ȉ~'i|9=n%y!yM&/ yT<?W!m2en3'W}Ҭwx>#s06Er-[- o>#`϶*/é]9 (OHG~5=='o O8x[KqA=c6?T^ ӂ Kz~p[l.jz<݇}yYu]^yE!s~h>nzms47h6˧wlci\DĀQ{ $(&Z~rB9$ @ >1:|#``bn`@V`RK^*]USwW}?=Ϸt>ّխT4H>"kǯGvWߪoWӅѦQvQ!˓p~|s@Kޝ* N;L$BL!O2T{{o'.}Iih7&X 4Ȋ[75gh`S;3IWWҼP4!H߹TlbwK:ik3_K`Lc A]wMXp4г^RH}8@f-*榡 J/Y{{&7Y횆h|\'s]ڊ"v/=, QŨ1?{&F0+Ze|ƪRzc^W[i(b<}fٲY~NbY<==Z"@ˆ+Ra?[&VlP?|ѢWpW%z~FEZz4G^_fj_!&ؔ`7C_;#(@+5hD/xDQw\Ph߾3ݧV߉_i;ɄXaR;E k^snq{Ұ F1DJ8z#Vf2}Xavt-]@ҔšR@K,HH$R0jh,a;.p?+~=Vm/UzߡlzGnzPDaq{qX ۏlnx9/}Z!Kiîou!bmWbN',n=Ud9ӕ{!}kW*6B.$ÑI/g{=T}V0X7KyLK˥_M|}2=L[՟[$kJ A82z:Vr* NvC@6%'`mL*0Q@sg{\=OU^(:_]5KQggͬ-ܲqu0={UoLH$y{ +ѩ Fx%%]o+HM\7 ,ƚ݂7^4ūde '1Yz1w&y[ /V$;0h "wH&'_"_FůƵ`vY\&6UsbO//=naP>-,7.>kA ~bAkg7]fo?Ų_B C#JCbɘn`B!Xi6" \)YYz8bz$`OW !*kh!|GIAY_aFϼQF`c ?ZV=sx*6;zv4D')6_4{06~wɵ;1c_ai 0B1[&kh_'n,`!,ĉoZ&a⛚q}gHT U>zwOQ]jCyDWj8BkE2zHpAϚ8&۱ P$c&gׁkA@V~@Ƕp-6-+Zuz WUEU_habz#׸ti^9W'= NMW/| ȇIfy V "1 l/SjYzuk{.q37{ϟ?=:l3Zb9;dgky=-{̧tٟd*g]gWC `vP( MJ3L0u^NyQGA5VXVWü  SXll0#[3xxPQEAPwi ܥB6hvyy 8,P_L-Pw\XSmڷ8Um6F՗Qv[O^ダٜ?sZJ+6qA-sM՟2Pܟw'L-Oa_wA@.IZXNq5 L|R٨L촘hX{56y W[w~H[\a},6Bwkʧk' ?Gh7/;|^S;M_4 v?YD {邆pe `'Cژ4[pN4 zrPY.Ȁ܂8M@ izEΆ`P4LM?$J+Կ|{`FAK b7f6v@PAQUo/|^T۩ Kh]xA|*7H%@Du9a$?ùs3-SRt5z P7L05o-[}ya0 #~ȿt>c4[}S{mJ:_2]9^&ZXv E_F[pxB괿]k+N]`6y mI)>;v2^o|qDG$(Ghh4M,$ K/sGqNXP/pkr/-k{C?Ud8H jA\rX]mUt:7:=ԦN{JS!zj<ƚ/B!t:xg(C?wi~?Tb_֖I( <_a `ZZqˏl|R>O| T.1 t7E}4m}>-]G๯@OCԇEn3Pб8ڪuף!X)" %1nחX+|goHoZ ]W=PcatBcz8;:h&rcz DDH""@rP[?I"4wݭfJ $R& ko٧*?gQӨ-\Kju\S]߲w>Kr47sGWuZ؃due7-Ⱥ)BJWF5W۞ ^[, ÀZ Lׂ]81C @.!=XRśEAvPDPn[P-3iEGd$ Ovm0mOqRT+0 У}TWQe(ANrGla F4n(9Cdz>.#{60K_s޳hC+V݂b/忬B\@$YdtZv{*S2~{>ʷ̫b Vη'Eb$lUhIof2 P_x7ߧZ_IyK)5uj㞵mZpίxfLHd)%#)VwYY|^.+kfo,E~ `q"{\KκKg~k\4lf}VZ{wg|;>u/ %<tӊ uEo8Y6]!ℴxs60 A_w쏣u{Y}R י6U8|T6X)Ϡt?veaNg~r$M< !ְ,(o0_ "ىdc]!FH $FO|)Ýwhnu.U,^3>!o-p1Xwo<ӱ0>o޷bit߶s#4ǡz 8Gu,iȹOzC^)H BOp]:Bi6%&Ma\W2;8:?6xvHr๣CT2Z0JUqR|~xJ3+>Զw-#!Π-i"ihg Dk` ,x|`!$~2'ܦZ_SFc9oZv5x+o؀0X̲45D*R@jbE=Uzk3I bF?~|˪o!sI:g?0lLǑk/שvFvZm,c{Uϳ|Gf2ncl=< r^X9=tj%uμxUs}F`boɂub Z{| .zŏLzW88)p~wӐqᯋcȿ.۱f>6ZK3j#l&x;oTUŭyz) k]S*S,lFs+_ga[.__~ h6nD&f%@1{:0(p~5|qPbGNc?O~Gf j?'HJSݽNI0B6+`ylW`<;#V,n槳DP)S`BI;OaaVi %c58Yc82>_՗e9HsZ%g<_Ft`:7ߓB\G)u#q b&zE@Il$4Yc*bzᬹK_7̰?zT~GSU J|8wUN+!|ϓ\#quh2&WJJ_~>bk4Q'G~nsof5Y7Or߼դ۹R0m\OBXIT ~]S m_]ڟf&w|gɫYӰ!O+sۅ\l+nSmR?զA H߱fcL%W0}MH] 0{D2AaCm~IebH>{ rqrgY⢌RFz'ϑ_FbTx}H H?[wvW4ZNn7bK_ MV[u/ 6pһNfB"ZocwǪo݊7Ufc;kt02.}'Z z BaOQL)$<{ߐAsǰa"e3p-?\/?hX:4ky+LK [|edظ& ~a?7{T[ Y&dt6nDp|Ӻhjo읱"6l$Eߦ̄x7deqoܺ7Ttw <[ 36fufKTcҎQ]S6/Rw\AfvZpغ=8~g]~F%%RD 49rN|qwyz>3Ɂ"b-S"%XTQ0}FFB"}7FDscwRp= \9 xSÝt9#c`և7O.|bJƞPv~ů+@eI갺p(n-:j%vdoqߔO֎alM+&eObRVd5ut3E?9kI{Q; -~gb+XM5Y^hC3 -] ZVSf\ꪚ鈉;>6?]N'q@EY;Īe+D _&ATn,ڜ'4xPԼY38̬\Y6B M|NڜGj0Vj`7ɖ9yR{Gz߻\]fSX+K#آ~_Ez%fRݲ_~jŋjJ?qs^N$ R^uHrO7έ \Qv]ݫ3 RLR<]W%8Zxʰ,ʑ,(Nz~4!4|L]SKe(\ƽr-$ptjɖm9;h\[}zNmo XtgxX- ޔV6hGo7Cо6ȇNjMag`=ᗃȯ>gYArݻ:#BaJ.7Q t[w7k%./ 1"g[Mwpp1 >42x&yNI.*Ddd=碚'a0 bRZVBR=U>Y'%b E?C 4D+1Le5KʹaJnol, cSnJ|zJ!)= RSO9w]޶eWbG35)lJݾ$ 2 T)#h^jYU:%!tkQb$VJu:e&ics1uI'xs #CE8Js˨%y`$u 0h檪'V!Z?jo@Mu'm Iٓ.VwZpFU[ f oY?b?Ϣ z! Thآ]/ $,8X =*5XmEnPgp&+ /9Eí1B34q^Ar2iNeq5DI B &/)x-$% s- L)]B,E ?l0$`U"3XV WWq™lZrZO?mdG MM?]~Ws+} zs:_~QaPUUY" z\ڛ!m~ _3gu?Oő2O O\!S>Gm8aֽh@o##V%S,"OK)Zx2IAD,Kh$eKTX%*0KY"TdMITHs ~Y鴠Ib'K{NbC΀_?2LTa`X""o6:UW65pZ'^lE~5pMe+?p}`죝(Ui領L-<&g⧼-nx,ˤfI*4mpѯ!2kcsR;2ݕ26csjR-MT<<ʙ-ɻTg5}i6ݰ<prd 0wVbxMbS<Q;5sV =[VʜYk{ D?\숭5Zp -{L`7F;˖"5Q*L%4lo޳Țo*@  Hh@$ $_]F I)_8>lФ&P%NX+*K3 'CV޻ ׷B]Up88~.~5r Hnq2bDﻣH#Ǖ8'Dqy?{~gewϳiF6=ϦT,_y&gU-s>rVʤ`˟kCjzIX(Vhtujk Y/jbYo?e`f>_'ھxTn(ND CȍoAeM[p2WG~ k?㟤]1C^AyOW zW#l^ W}=t+<7i޹fwoO*oq`vK26rʧ $_Όjm4Dm} (٦CEHH>;+EGj!"bR9 U7 !A)$:v&}?Cq:~wA7]T:mA &kxA{o8<w?^|-ZߚԿ:vdW?p߭X˂h=Ydພ3c93/xog)悥iSg o0;^ovqf~_r5uY̮jc3`Fҧ\ qǂ~[p~*.NwRzwI`t]>Eخva8'(o> j'eYV~:hgQ?!Yn zYY^X#s%G//?Awkw_?f^%&UH- fDa qwzPC+ =aXQptLjP{i^1|5LdQspd,vF߄DC6ԝpJrtH%KkEi[%S8n1L;:8nxRG2RRms)o'Ÿ˫ѐjdQYGpYWYMC;[}M"H,)4–t9`ȆG&c"{ L|K @/@YW1Q3G30UlEwS>|Yhaac='syxw HQo &(}!ڻ3S[sKmǛD i”"cy;[_ dq/@=x zKf,?d:_vD?inJϦAC.Tw=i}Ą Gc BShd^9y8ԉLeӠB{6(bXp0fYNFս޾ܯ|֠6+e/A E ˓ M6h۲;OWar,L쳬6N " R`8}[ܦzVQ.Z .5 <4\#o:A]՟؉k4m't+sZyʋ̢ӝ<@-qRgf"!ETg+QHPH xĻBexSO5bQdq]bo-f2>=\aM$u}/&T9'>ٟzkZ>7f$=b4#f3$&p+!i@ZS2C@E@U@&QʘcͰWY' ܿf:]_r%NqlŖU]io-y{~}UI綳::]v*rKՋKf6K㇏k:ݻn֚l>ܶ+ᝂOaɇc@!}BÀ4NPH`\o]"BƉv:ʎ }Zl)h pЌ H$BIm$P'\7"x7gWGY~fIz9,M!dU I P./.{L0o/T5E>y%ݖ<.y~OK[M{F}~e'^% TͯNXeq뼴s,0DF6af^UZ#?>B}[m}J# 4{.rٷ4ݗE绀^ v# \kl.QP>s]ddW jhJ}BX/jq}o_$EGPm+aD𓁂5=BF!SͶ4MTFԏ?fJITOyz-qv//[K'^R؝9-+xGF[yF,OӮY{K|< ܊gYm\m.>*қ;޼5'UzCi@tʗi1M- 8A 34)Ak~~cm t?}yYV%!<ҎqP.̱& ~ Pr59[ɨٴW7spIDb}~v DVߝRD1"P~k2:C8.#֞woG:Gd>^ĄAgtS}fL%\CFmh#ȽOBDz\ϓ0ӒOV,O!\ĺôYܭwk^y'Z } LY0}CwK(=X-.\-Vkcj b#\YY3]ݻa yn]~2yJf{PvR֥٠e@Z T*5*BɓGt|-?[-DQ"?{}NFaT1wY6-SyK\bT)((-PoaEKQvPSIY-`mE$ڶC o5~(s?B8EEP.?yocI_O7OȄsW74oUU]X_9|?ON-;~vz}$wa=W{y.߹Zj«e ?i-K8~?i9Gm5\ZUV@L|PF3a~WFǼ8 9D!=!<|?ҾcL| 7 H3J!aJ"=yjWI ol%8꼼?oS7v.N4}%=5v*q}RWr}~e*v^¼YJYwЂ7fVI03&Z.e#^)[Dv5g;E08B{rf Q)8g/Ʈ5=Z@JBD@H;/1#")x߷ ca|WBT//7 MfO6Rj'6o [^bC]弭|{쟵eJх(@( %<;}>YbM2T~v-;aˆ94o{Mmzś=U!iei%% *v?sS5;^u}ƺ&ߵ,!I>ue!Oz#[!?|(?w@kP_& ʩ ! &2,Q"(h2`DF4hEmEV6ŵcV5Zy! I)?Sh Z:w_Xy&0C[S hpm}Ƕx">菶=~m4e6C1{F9Ʉâtix@?`uj`c}fu# 5r@;ɉF~_g2v\'λD)L%ÌH "A A [@DHUG I>@AN) mO|bEїkPxyw yDKGĶYJ߭D-hCFɉ M@JWIDM_hD =4V!3ܽ¡,qܸnqax>{ydZ\P\T R\#(?YPJaJC%Vqn6em6xBポcUkLbNXPʶfc:/n! f jXf#5snXY uX7d\ nQ-#a8xS6|}`16Y<1nEAḡ -edj olŒHI&X$H+o6G;D1yK&13 Hz/.S*L z0> bJYiL8H,:AU6  9,֫Vl6,ottɾ&^5JF3@l 4.`2E13sS SF isS`]jA(D`s+g°49Qa&ĄVVJQHfIM,.&6!V6X6q3$t/|X9,e2,ʒboRMq ܢE 9 @$JB)/'8J#ٖ=G/꒵7nл4d`bev/ԞThZ4XNfⷍ~wdV"(+3k Y_a {>.̻⦓ NWtomBf:f}̅SO~km_ *$^U h%ŭT3~% B؉WJQDiod* 1:a aۦ\_WZ;Yg|WϹ;ʟ~Rn7\8h钽OAVK6M7EObҰF$ r@f1 !8`Z638hi]]c[^R%W Y ZV?fjh9:]}Y| " la3'wB$OUgu6+T"YE A DD?pܞ1Q)1D;Z6`K b" lmЕ%Ҥt@lRIrɀDA( A.PH "; qUa~9~5Oy3ŏ1G/c{~x۶vx=DuׄK^׎kLK1?!u''$Lo3k~ 3b3:+qgtU V-?6s3Jq z?beyfzX9|M^)׿D]vJ_t fKc++yNjV!4Ho4^M@0/HcBm01Fy;Ū矗i3'%Tփ]&c54yKGgs)yFz@'9`J +n~?F@S X(?咺\,{Wp5J\8Yjhؚkqs n³*bKsnZ Qvoböz6Fbma~'Mq5^_ԕ7W 92r"P,o%!c*9={uΆHŝs֩n每MOgps-!O_fL\}); [5OÍfc\+6vL0A~ƚh<)l_~3R#lPbTzP*Y"(2~gGgf 7^s4T~\},bE4^Z¬Q[ֽ-6-mZ@D B 09+3ꉟhW;VKe[ ;=jpOߙ^^ L?_bw>n/@UR|>g۞}#7QJ7yVWݼoѷasUJ-NWw|}Mդⱁ;zcEʯ8\+lYg@y{rx7#И5)}Q eove5!! tJHO qq:8JiިHl=cۮeOqmҟ$;eׅٯi#j8" @h4=;=|OCνÆ~ {ÜG,RBh2y wN1t8gh^CwELZ8߭nj´RH%7=eT#>%҇͑=4ӄx`&(g_j4dƊ} a8j-")N{\pìe9VX> $P$@Qgo]NO]hoo:TQs~e7q 0IC+U0_c)A:_ԃi@Y55 %6v^i4 2*9zi(\3Ӡ>jg-[&qs^ }9WE{9󙻧@;gfxϮaR,y5RY'g*M{XTg]Wpܙ1xCݱD6H;$l=C-.u-w3幷h8pU[_k{ͧ-_{0 wy7Hʬka6K\އgq}+='ooau\Hi[2eTƝ׾m"K^7:ym@+^kl#vFK'0{[(S%I)M@y(|RDv0{(^ f>-LZnJe-/P.z?L0Yih)˘S'A0|+1q}tU?hewv䩈0+'<,})WS$n61 "SVL86|qG/bmWCJTy&3sga_C㨒^] @;lLY(%o~ 'fjol3x_'[-\fqU_gGVjlaXu͎Vw?&{dvo-+ryo~oM?/-ԧ%z~jFPӝ^~;W}y#S#NklNjW$5]e;M 1?͊|PU:<6ʭ2T])pLnOaaEhBwܾ3wb_K1^ -oOLSu}>?m˗ͽvf_;$m0?KKniJTm`5xAa@(WSGVukג0iJ DDQ+G6`wEB>4 "lxJ }7f{Ϊ'XS(MMjU =+_#_eHF@uycڤ/ /i1]M-K3򷥠sp18 ##?Rw:P7\oN6ɝpg7% zL&/s3ekm/Wd9.lbmvrO~o.s4˳.gvo9';x|oNtRlz?g͞ =,G2!*z??:2u[}oҜo>%1싽}qY#ٔL={FYnepyt7g_:? ̹z|h0 _9+^^}'$ 1DRzr[Ck'6G롪}I}Wk5fݨT6O|Z:.r@pp9zH1ED`;!Fv'w`wBQsDk^>c*TD%8 `PT1f?lV^ztT8g1zؼ24{2'D&0ԦfߌXt5jD!K,Yfp2:.@Pƞv9H-׏^RKvaƉ]^<έx?qk:0&߰Ή0Y4@D^kɥTHeLi/D` % Ŋؤ%\ad/r_ð`nrG?{v*%qv-T?2<)Fkޯhm*̙6}` DSËXEIBb6w?G1z\'*Z  z^ w[DC Zb)jge=gp0.5c-ӒbavWԅ,RX$I|Ha$s_mvGCfSB#]p/c|Sy}.:[ a(OuϝӜx;sz^%å``BQLXEKT _޶&m"C)!xS;=iy'"[X;4F̈5\)ue9H Ԩ L9@ϭv)*b–ݎ k5D:5Ƥ*]f/ZGXdm20Oz~[Jj.q͂6ޚGyNu_vEVMQ,l1<[=X}CS)ĕTe~7OչbB*6}xFIlw{1$ ]l'I[A {T6'EqD+D't0[+Mތ@k*DnVCg5s Q~|Bw8sK3G0t`Bt,BvˏgZl7mJLֺ /j9I~F=>R-?_W;{ }OOmx"*z%uyNp:U>vI ,>?,El?jiu.Bu_.  P1YYb4=y`"$VG690Z䷛F\!< |yH@0MDD~H]ZRh0ۂ)cd[mwM 3lͼv[7 o8e~<|wz*L7/V"ϸ$&3қGb#!{{|%bm])gl`P(ov}}aH_:s]jj@y~ؾxP1T^ ~s~Zf)#~^Gjj7ik))R>O|.o2`H'/vqm+ՕFD33<:֫\5/i^=[|M[qxxsokd5j/^+OkyzY鄐P7:ALB,1l] ۲x}Wc> Tm3,6< 2$0 DQ l2DT "`؀z3Iz&-dΕwnLz-a+Jx̏)=7o.ɗƽv>j-Sw7Q:GsWp2T3wS`5UF&Dp-AR$PґrqK/+osi(7 T? >k#S f|_$2ϦàW~>UҚ{|7#}W-[sx˫C^_zelm'ckZytJ/cg-MMd幓w4}EVw85RF,kq?;/>}Jm"3Sa@e噽yWƞĤ]@quPeuϯ,y ?xZ骛kh2JѰp(ؓA $^4lNudfEw3eϢAԪpt>!" X!|: M99z 87M%YCʟ_G.pWInoY`d7|1wTeU<5 t:Ї/slt?+<{SǷ9D5w {m|of ZӏjN)ْiͣH=ʯw_(\DD,+pkK}@H#C?n/8hUo:[QYO*ǿH{wsO UsQlP`[0c)DA5ap:`jf{a-i0-]ƿ-z _>;~ǩ$H ׍az۔=H2JIH\m2&X:\>5"`YHyD 8f{ h%ggwS7mHx$J$ rM#ػ+H{rJ6M͖}s+ҠQ K*WNe5>b\'+CT V,[Q~v{懕k6֡~Գ;VFp_.T AAltaaKrU7zf [s|O)7 =n̛Y+KSag|[u;k"]33i/y<,*fg#gfыƳghuݬ4(s;n9}syvG2^`8 ~9lZJSl5.XI-NDnt3[GHD烣6DJ>#'>Oj;g[3m^[ҍk(DCo75b|lNB͎&]OK!Pɉ /JsbrV  ~ў-i0爘' 0D1kmg oE~l3gBzaR|D)PUDn cZszPCH_鹭wbn?. bG:D)ڍFH`載Oq܆cܿsGKo%);PaD1!z@xB=Ykh:ºǫ~^᯽0&S`4e a+<ыw9O9[ͪ]t?3C‡@B7nU>YVM|}Yd53_ F}?M׹%5~-UwGG+]/O?:i9X}=71;76 Ӽw&?uԍ\BLnCޥmzR=>z䩦=MD $2hFY M3HlpRuNU]aQ]M$̞:gҵD8d5my[o.:0(.H;@6@!k8@^R0 E‚(Nk,-f=k`W⬝T<8սw9lECn Ümuݘqn <;qd,C%~goԪ,=m: N e H{*(s@QqGHL ?Yk{P)ie !H2Utytg.Pߧe٘|-}jtSYݻ}`}u V0@DM(WA?IA |>iYPļޝ+UW>3pPX([s6x+ ^ jAJs˹ȞT6d e!PsӧX, f SӽG\\9 _Gٯ45k15qq Qot sVLdt1]" `㡩N $?Q?=(*?*tٜU7*m$Kb"B@Q-,pQ>x_( ~yDD#Z? ޾?kV`y<Zޖc6_8G {*+d/LXo$u^vQ ,0ne C;ZIN :DtFw3\zWcWi_m9y%b/,&PIrrv#j5iw8'ˣhؖݵao0O}_\bhӹn 0 `/:8(:4 - Jg պK-)Qonq%Y-=V9_ @TSBm!+I8Aז O׾zt^t'l~tut^7LӔ׉D2(,Qe0P >Wnv}aط$|ISf$/^cLoMC5'dyqwDM^ ݪ25 Faã?=^CI./^5I1JT顙mSER6i ٪5I2ZU2*Jl;<`]^52k5~6~6#q72q2c;He!L& [[˵]"PJVZ6V{؄Wd{oKDS!+ȋW'KFV qe2rZC+C ,]Nf$P'л-6F{|e:ހN ߸MY]T4D TǪU`L杋tCc>_l!X@D ]wWSe6Yb޺ZG55!nS =KGj'. 2IHxfyʪSØ*X wy'9o>%|vDeJ%H6d `B*m(9TB$AI$L& lPd0`5v9Ƭ>6f;FQby!U/*2P(DGX QQm\EfrP&B,x(g zc˼k-`:Dm0` ePi"g21KAW,nlKGeߜvzL9YRs=CgGL%s\"r,_rTI4`#¼:zѦVqhi&Pv Cݳx[|0< ӕ} D9]}P)@bL`E˸)muCtuajZ fHآɰ&J"m!YS2:Dг A0$2C1 '1JBO ᓤrl9 `CSsVFULCL{>e_ ų:EGe5D*Idd&=' .פ8ӪC*,,HD,c6H"PBp0sZ0XȊfو x]jRWe!S#Fqfqku |̇(v4ؔݧk],c1]w8h 38GCmإRkR|sQe# ,["UEr9غ3 Z x$&嘋v hgVƵA@ff>B|ͫ QdI; }{tSim-[0*fZ٭mlI6ˉߨ}oW^l1kF֔ђm"[jmj&Ym&ߖ4XD!PeVT,JaJPU! ];Ї}EVLA0pi|C;T儰*BBs !(4Qk)R&+ڒ187QI4F^3Q{\L^IW gBV/d%S:UW ^(rg)8b WMԽᣈ2^m^tbd WDW*nzT?]ؙ7~t6`L 8ވ?W=zKn!*#.ߊ`ye\n>j$TQ"m%)!*T> 9U掗q_ F 2?oC@F@uZ9;]OY y(# Q h߇ *:q؏ۯDȎ@ѽ;,|9#4243DY;YCZ)75dm CA'̶ 'quڔf)}T(Ap3 2mT1gw.vkyTB1mdopZHϼ63dQ4ܓ}Y}s,u&Q`rCEZl$=)ﭳ3Z;::2ek$˄,p_S\J5īD`Qpoٴu|ޗ/[^iO|j)ÿe+2GΖkG+-ǰ}ކl.C3aߒւrA^[c|@iǗ7ò| TW58׹q,=nktIjt_R'/7.eÖŠ D $(c͵c0LgQ(G$'tp exǒZTJ$N+ G"Ic4;1e?ibhD!򗒡n Pz #Tkoos`O彎!048<ČA>&Ełv3g"!Qp!|38q0 *NE2FwJlv緛k eU3-T ua /eicBXcKZWlp80\sϯe7cmWUYbm{)Y*ioUగs>;Db,Yf4, چ D;VII|p`%a`T·#=6GksŏE Ig@r8Z#&\I y Hc󫡇ho̸ v/kU$Sa30T ٘̉=" 1%FGysftsҭ\ʼn3IS6 qO*Yz"$br,Hck!Ѳ2*q:Ǘ1W9J_=d՞.*1*PE"S#YdS/Jd=7P2ENr٩5-?prЉv|`$ʞ8L!Q0TYVs/KěI]O&y|#(rdztlbחNjv c-bX⁾4tM_y攎_H!G#%JJm*," ND_M4:d-(R\ ItvjgVj;{-k$׵C5˃;tx gcv#j}fj`aWA 1 ޞо]<՜.dcUHPOɥl/ѣcNp#rLaMOq.de2%gS lt$JA"z3g4JvD4Gr]ee,ry0q5%2oStbB6:tVww6 %k`Hj8X)ϑ$qdfkkd/Z'1kCocyy^9YuiDL؁~=<֬Q]'<,)-Ud MaХc Aeʿ< r^H͈ j%V#[>sŠk9IJÃ᢫ΝO&1ȍ%+E.ر =pm4ٕdK&cg %ɼk/-CXR7Q#l1`V9.ek\jS\%$^ȶV{Ujmxo+dR g3[ jZ/UG'i-MY9 9|7fY}{c4T!.aI[#0O vJ7pT _cmeBOBlcipHb bF ƘZ=B`ګEY-zl:F3dK !ZL ACi#**%s=^UWanknu CwQg^rA %E5Y^JOMEbr;I\f$p>W JBI',X7O52c{iݛ䪛gf -'")`$FV{"~z!y⎁R$9[ 2D8EGp-@ւ5 kņi 段Zx88qqU7${4UY*'V5c ^seS;V ,e6=05ga, _5$ΣV3ePH,v2 ;`O9ȊhpA210$-|AFɟB}FpqՀ.:}6GI@L`狚sRԋiY,H$hvٕ{Ccݲ["J \qDk|\3|gNi2mn댅k{fhܲ5Ma.!/6FgqⲮ&:6j)NV՛ jøz[Z0iZ 6*YFf FeܻcpARbͽv(YXK}=^1G<1<5fii' SU8[[ V;Ǘ7 d4T  J9Cgg,9&|XZb$Pfϝ]a\mS--dؤ)K7k9aKi *mIrtDL3U&Q L[sD14c\N&3w!5'TJ)~k[l4蹳b͞u~O;'Uw 3q )=xAs\iCqtob֐<oB ' E)"]U3FUTEX#S8A &m1NQTi9`WtFJ ȗAoHLxt aԧX*L-J1zϩH1- 7#zq(ȧ 0#wBՆv1O"N \0L %yRc 3]<5sI e,+K 34$Ĭpj[תW gB^WX`tQ)MwJ`ňvN0IeRU@ix`±0XMi^E[_;K+pY ,wqE#ܫ vo Db#R> |ޠ$3jD竼֋.NZ[R'/ݨQȣvTVjnt&08mzW&Ő\g[%1XFƝZ0ީs˾9U\0@,[t(kڲSgNςps[&ѩ$/0ulm+U% + bj.-g6ܫ=nO,sKj5mz2T2*"#7(vvN2:ꡞ XxLBz1$uv0[E0w"AF\Y`D*5XP+@XXI[̕ 䜭Aus1…"mÜȜlp؛ ei@Q| YsvYN6=XE @A$Q*wװFs O5e.'BK {I֜-cWjI07<|XVY68C iٹa;^^FψTTVV.guG" lyZԤ NYtpL@ڢ8'P5,"SuYr0`2ZT Ct'45BYnh=RiD94sZ0(T`,vXM6yxWLFm=B "le 5o׶_Q 6o0}[In:83LWjŒUrH鸖pRX!fƢӄ2lP#PoWu@9n8DW>`e`^RdJ#nX"Ux$|1cz1&9Ғ{G-!*r&KX0@c_bc) :p7s%5yĞP/4N22+!yHeqQut 7_=tlVR=o8ZNM%fLJrX&c)'%:%7 vr5d;lȻ֩ rAe 9 3JBWO?+*֡J5e:+*ԟ203=d^IQs)(GkoLlfljLI x0,GavhD D4 Lc3V,h4JTk#2>jR|LS9 kh wNojzdU֔fw>ry3 AXR\ֱQ- TPȁ@%sևlWe[m%2wvGvhp&:9dm,\yGpc1gWO<%fYL-BHQD@R=-ǔrm=W<[^`|G@^m&Yˍl)A75pnܘ `*C3aD=[(~=#0)haIA>HQb$!fMRF2B= څ2/ad,b '{9p.{r˴\znVo$ JՇx-Huh-aU tC mܧ$p8qөcl q"ϲ+Bjnkzl]J2EɝA㒫Nr1'(|s/zPpPC,@&kم(8,1F #kJ@tJqdS֖ ]2{2ZdLi`3;?XA0,!F/0ζ]zrAHj=r0_>S4m)]psP 9z@)r7A-B/^3H gs{Må֍O5,lfB L&T="DVia 6?[q-eL P@dg>ܦ/Igí"+]7H_o=;YLKYzBdn?S2r&\AX9VZ`M! z⫓mY35{1a`rKۧp J2ѭYn3i0ӉXx$Zǩ7Bzi#w|iRfӌ1&"sw~ėú<~$ + ƐlSg| 6O[{dz"V(H~7*S7NVKLw E()*jJI`R9n}$,Gr pCD@Oﲺ_t13 x8:iT_} Һr5ss2Z-T))FUN7:m>N>'ISBocg/̟Z]ʈRnX 6m&lCm;M[N$ 3i)7qᜉ+$&e+vwE\Ŗ~-'/' L"@ 4E~)eɠ)X)[51],_xE g Xvl42Ghʹ1&1jaX}28VJ~|9qf@Z -b^U.iaD7X[NqD* SbwPx0;u~N #Z`2vL[ Y4!KGK2Itǧo'"Ym\f#Qdmt`or|{pN>0.6"Ua7Ϣsg i+ѺwvؓI"K2a/k8Ҭ(9Ń.\tS- DJBxmo/skdFC2O2[c9 S2LpY.) PFmjLrߠ[ϝ/jT>/,k'է)tn=JA\q= rvyq}" 7E.VQ,%x %nebr tks0@RTH9+-'VkBHrz5']4_Ås'yIAp1ė{K4a\9Y.V C(`HըME(h>U&AD٩N=**RsրV-&6yRH,5%-*v`!-Zҩ1A"+]+M}q=cYQP&{u'sy F޷c7E"S+%U~$rel1Q&/5[cq:ge2цvX rp$I?cժL0Tܵrx2Q̢z*ِQ)6v,+x+@trݿvYPRL hʱ=ZljABZtHV6S:tӑ;cW?š56g<ɶ6_"Erҫ9}s ,̅XW|O쟊`U[eqcDՈŵsnf M$4JEzw3M.W:qnp%ȖqƖeiAwWk0;d-avjj= y qX6hWqh؅&E%J6 Q`LQ=V\j4h ng :)2RCb hT-{77> q!o@[Q52 C! §O,sBr6=Y\' r\4 02 ћck3pC"(Jz-7ԦڵL =Ek49Ac,oSlj/' 4lT7wf'kW?3gS>!xa@9E5YeVi3) 8FA 6iϾ`/S-ĥi^yA W}0mp)4Z]Qt;z9 ji-.@hD槱wY4א*uN .&1.neyiꦽ Lsa4.7nV&Lb$"e T!nZY1A K*}@Ơɚ<cpEl=2ՅHˌ.Tu&iBrTO.\̯z?C>61Yr@:Cfk$Q̹r@]ELplQ /RmBՇgwkqx_hNNj1'2jB@(xLh&ӮFzQ%Xyת,cXjlZU. y1l c<5TChq-۷x;عbS u"ܸ裃z ٍ^LU=$t&uU6&#SsD$ʒ!r||WlU_O)ă%) |\6x|DIZ_%? BI]spsncKs各DyA ܅kMglhio/mw Dcl&(iMıRYlC&s;N8 2x=ylM&wnom3֥WލZ>6ex,H\Eǯ,CBJJsomC'b"d^w&]Espӣ5 Q7;zr4gHgyf ŷ~MdA=֕74XW-. 񤞩ҕ r7&7 q1ةtΔi /Y]ZL]7oA}{7h*6ʴBS kn9,5$,c; 2rc[Ir(>W 2?h Úhz <fP?kTz3'E(i*+wqEVFLݍ&>78wS~+k^^<'x*dn˛2w]눏's͞xXO(2l]V}M/MwUvef[/Ȓ_fD'Y꯸MҎj909d#Q>R;4)(RE|ɏ- A?`7⡽|Hf}IScr#4l!nxJj{1Lb[f8D87>h'S+Rw ZOt:٠2zTx.N9Ùw9~ps};ɯo;6Va8h^i|GneFBlR^+pMSd֑%iE}Q*8]Q,]3ڧZZMIhfݕ'o:/Vpc""" -$r3+GL=kF p'Q8%7zLwݝKW |6 BlHgڒ93R<TzF+alh$) M.XJ b-JcJLDvzOQעd(fy=rN 4[n ! :"M6u,o?u~wJU~uym_̖h_^7$ꌅ8+OMꞄImjeȏ;!FS`*bN]ȟ6d? jΤ ѧX `D2=" [ EY P3Dyhnן6V;ܻf Gxa^a5B@4 nfb윭v&UNǹ-.tf:8馳藕R!J'IZmCLVYT0_|!]]Rߌ|rK32K%{D|_!t<8Md&;D}:_98пq;x)뎬{8ˬf8<$SxN=MToE`^kʦܡ(  < 8Tg&QpIlR^CE!Y2l2Dr !tIMu1Og•̕{ҕZ 5HJw#|*ٝW}|>V.mi. lvhRa5ܵg9},qyI&n\v/ hl8B&׆]ᩝ]ڈMJi(gMz8].QDfIU}`Jk D4ؐ'_ --Ukg~ocI}s{uVa!iF!KRؕE9{׌59[7ۊ KqhʊnEMEՂw+hFmͶ8Z` ָFri9fN=7"nuWs)V $l>:;ySOmM..}Ls]T.ӯT(Xe< Czєkm:>Ë1Yf9Q#Ό1+ߞx>sX<} 88G+tSx|l8vZ<8BO0qt;175tҲ'Y ksZ/%zXYL9d<xKYFIX;;IZ)X]>$ݮl!KK*ozjm۟Tq]l#XI(Ս@[ѝzrcYsvXyIck^KGL5ʩGs뱬#9Ŀ,+'IW!R;-~!9>:sQ}(1tĢKijiXo20Cakn*Zh]cѳ)XAN#$sw&8olC FtIʊKNyY(:KrWm5YnEͤmf ]yk_&NCVgW*]|^ܒvO?f4ʓC{f%s^侢<R`||5-wƍkka(! '`yR~kԞ'WdCDckPv<փ/y 7+m{ I./zZ!`1Ӱ1' =%f#+L$ l.T*-*jzNl)6S$;}-[N<wEVKpn}E:1@U xm"7ވ .UA86݁{bÑ娞~P^C?8,FV_6$eDZu×A#lɔlc ~c%+ …ZdH] 0ӑfS^+nO4s-aTdz~g;r)}qN 2F{4yVDk>nAhhܩ2c&@JH.+F6w%у uQUiZ^S6˞͸/x  wz!*Il/?^}#ՂgAYؠh<rf@yNNRpQ0Qy0bnď0I!t? 0y'>'\/u]J k/jʥG\ D*(US}AHHaB3B RTf*/2ќP!J3Nm7hZ[.5Eͽ5ȼG㌵Ys177h<ӞZQ'13B6VXXS4zJ'aҦm3鋏:yr'? ^ \eVm#ӰءMlLRaUš3ϣ^thPQ[W7zJ}~M3\և 8I\rbR 6ہ<Ïahp/[ 9ir;8%p{"XW%;7s?uQQrH,@1`pR2P?^tB=_$hqȢ- H^+K &xtyo:WhIx^76c[K#7a( .W@S 4Pq0Vy<?ݤ0(Te@WVs.CVxq "LGY1Qj?\˞v5^/:c$Nʑ;Ώ|Ne9 "+)8;\X c@Ƈn1qE-9y>9 jۯF=+l?`bī`!ָx"esE͒Wi k٦i3g&ӻlpb m<.bo~<áom~ 0-Ԧ ҢÙKLqHL]<7,{,t=,|<u.Žj1^w;n%1ova|pLs+Ɓ DnkWVc2!!OW;coRHmEŸ́NFaNۼnϧC}ԥ,:1cv]~\\E%U? <||g!n2eW fxҚ./̛W=o{߫k-8⃋Af%qy?L,+ߚsMcc/]=QDSB(5Ace=Ue_3$ ߽kf^ح2ش` vdhT?T )MMqoKcnG^]xZLqJĘ݄\FȊ88-[_xesAv=lV$ "@)nb7 2jxk ||ِv^Ϟs/wj{;}yzF\o{lwneo:w[Qn[fIS\w.t:gO>-Wޜo}Ϸ}Z7$:5z]=c-g|_syZ >te(m,om.xoN]xoy꣭[{u)}BXSmHU(뾡*]YfYJ6jV,d[ @ hCMd A)@b&=!/l64h:2|ـ>㯽wsB>wT=ضtZ c}@[>*vQ={yºVt}}yFRWsϔC" WYK f @ǐM_wڅ9 z گ}׶FywaE"@ 7Emgr!T =ުE"*$D2@sP{#Cٜ=HUUH#H>z{_olv]lV/{3˭"oA=θ}p;`>Ҿ=^pǣaehoRR-Ǚ$$Y0}_V}^E T(t^^wyYs >t64$PnO{{Hݫٻ>z_o>fvrh](«.ͅ{ UT<͠4$ @8h&CL44iCS! ?M0iS @#F4&b2bmzj4hɦdO)'ژ511OhOSѤ47q?<h} ?WU8 rMz~o˸}L:s+}< Z?:[ ,,5k`纺Ec/_<['1 7`v]&R?&)w3͍ `5gфG<96ΟՅm^zEuX|i$ ԉ~\+M.&I\TLN.0 DF{; ]hx}C3 RFO& X1\B)w&"Mr]" xG9 |qFAXNMǎm mˣ?k4 1c޷ = E<_KMʹrr?+=#D.._ɧ0PlvK8-֣%H`ϟǹ\,Ek{匿ug1GOjS“JJτ(ݜ ]reOjݒ&eU8ܼ,8!;Zg l;43Gwܗ\}f"2;E -!J  :+` *–hgx=<@hT§`7umTBmޟĄ!a6-{2' ѥ7dy,0ˋKb"EPTTﾇ3at F8x;א!H 0X O&(lބ& (]Kr~'tʹk]BmQuj_]0Α~ -mN{ c@pq%RaW@UWv[Q*Uws2$]3!ZB؋6%/sYsEQd[ QfH.o#.uhwd6e!Hv!1ƄY}^z1oqThK5?J_7s. vPig?gXJW6 D'WB`eb'ABװʃ&%)MrʭY ǒ.xd<9 ;}u~)6C>&S=!y; 8!3ECRYA=~ͽ¡9`2Ӧ0B}թF@?E0潔p|+hL@Vl_̼Y)yR=zi͇K%jOwT͊ykq/ [O2JHvw ʵ 5"h@̗FсQC:C0C'F&lCzepZE7[dNmu{mVW Ʈ&M珰Di3#0x)"`ZB/kcLyyC}{i2mXD@k_> 0;"uOܷZw7=.n2G̎y rH\7WbsK1Hlp4yQK{/jkA196coj \Pmew|W{M- xRPQr10 |ڒ˰m'Apry($!ތJ"yjB'2"ذɃ:"Y)tkIEU ` (fVw)XƳiF fᬰ2pE+CJYD+I Qu0 _7)xIv/^4P0ѷm/H9!g-"fX|Bh^HE1q-,*6ܐ 0*me:bm/WMrW;9s*G$GKک|!aGdF/7~x.z9@Tk C+a,bHK>Ix3kڧ-rGz>gx܊_z5VTG^g|+1GO$?O-P 96My9'HGԢ "-E{z n, |/PQ(,>,%vZR7Nmi21B s晃wʦ:MӀ.eGC]/kuE$X,8"WD GC֚ E6Y *(" T[೟o9{lNU%@Z`8A @PPc Q P&/_!MC,(%{rp\k?O]^AowE5Pwh;JZU6ݨlڷ-ʭsR财j8u4T5iR(,12ˑrFfcXkTd4e km}Q]01.|ڢ+Kq%G39k J1`E1) C_B쑛!YٿrD+:200A.1a^/FǦC_9Eoo˧ωVZ0XYTi\^ ޓ*㙆 R=^o#7e[A/͛}a,dtWKM'oFI[!Š|~1̻sIIF~d>1w((zgl~%h'mEgpya:{?e,i_( #ϴӰGsUE3 _/kX|ϧO3=MZH@LC,U[?{+}19ʭAC />~l=oHAd$EBHNPߩH|Kx ]%Vzx~ Pa5E(1 %rMi$ ЂAe1X eFt]A8ps.@g&O:ffh2Iw@`KVx&WFzm''uaI2lژ@ OK41$د7Vi{`ШʅJ5,UAFXE&s9?C_;?-ʅɝ15,fShlN ld( >Ғu"v3pNhh%%%mBba߰B n|h(N'P# [n_*$~gy4wJ`|.Mp?LPHDV0H*DAZJ(, d`R b*)Q*)Z2(DbZAHaP1*1 @U!;a F " l h0dB:fBY ɑ%?7t| Ch!xͰ 0b2[֘@3K A+ٳ|Q"^~\=fL'a3ΑU{6g5?[ȷK|Žz'YC6%,bR" TS/u Wl=}NGpQ-ߖ~?'eڌ繷7zer;[GB tBJ Y,>tzݿg#GELjP=TRp-Y*{=ޑ=C|/!;qJ %\Xbѫڴ " R7?SC7VX_ fak'M ф߁ħo-z8=2xUҧ4_69>`OVD6cJ,=WTw}(rb'*wݤBRHPq2aqd[i&\44NpN[8kJFG-P aKHASaӠ&I.b"{O{ gW-=j :rD 6ؗ=#.E av3k3žrx X\cNmI BHb䈑uz\:~`$w1L@|paAp.?[ltHC5daAh%"s WW  3)OdN1 (a̘|#֞W@yD xXgT3,>@ơdH h=3^al*R^ q.C5"?3~?s3zuzXvEI-_z{Z!ؑ,4yyL*8'0EhsBd&#n<>`'rWFj,gpCVby`--=! 0 ; 'IX6& υd~h@\" "aNJRG w[z`;\ %E 6r35avvf.}I(!R=Z(:Ɛ(IE~=p?:0DidYѳHOO$$r‚;BLJB|T@;Cn`D/`@nP(`Mϛ왪yM3X2tuq;H}.Ǖttmca(# y')a]HPX Q<Кay% -$*M,Woxgd6A4 uvnjL^{ B364_5v bb~S jlsw@.B%옣1iE%E7F|oܬ* 7 τ' s7RhT]PEd;j0uJscRbg lw|m݉Mr%6&vWw;=ϟ[chʚk0PW>F,Yas8<5v(C6Uj7+۴O_>W( L[,B$Xn1<!z ?ўcł48:ηFǧhuNEi:[g+q8+J{Rů9q`o'W{6NV%"B'2w>h"v>'?(;|mo, H}@ `v'-LmR6pBa yAzT/}8yePٝmBd!~J=6.F/8t7W) K!{/f  H.+~%2,X< 6HߔXV@8(_؋y_nkA rF|>x&?FEé_HJRӮx2&1%{4q WgU0@*v\$PQ5!}\I8 ,+(gMR񒩷 J ;k~7M9F/o[lSC߻υ"@ iȪs0a*uI.a=/;~6i|3y>OU+#mE4{0&\o<3kg$BNW ܯ+P2f%? 7(ki>M-47[1Wv잟`Jfnl! UGF2]h%R I+"C}onUXS{AOˁ3+{g ",_AMu&ͤd|Z+dXXZdwQ)AccQW9]#* Z3!v3o}h%Y\IKe$p|#"dXhfE֢ݨlC,Gtco^04bzU0)v\H-;"g@~ǖ xL0Z[-Nt"k *yIFI^CnY;G%=v<ŋmJTZ* nC/c{[T8<"ua5!oO~,yNwUutt G,2 Y$AP($Жc&R `X% Њ0JT>7GGΨ"o&gTwgh#Ӱ?/4Ճ'MJo8+@CB9Ele__KNM@`(|_A$wH#AhNo8 oh,uGcyn+!7jjyEw8Z᫟N=)!.e tt|l $@Cz|q!n}olty!*T$XtO_3J8Z"Çw{8x侎 yt|cmuVDlr.ۊ!xVP~zv}%a~9, cmk3b*8@M͢ WQ+`_7e73No:uzZ*AQZ R' ޝܬ,)|Jk|O&C2NshnnӻIFgrAՂPw{{˯mEv~Lf%A`AhmrjZB`9>ĔDtYzgJΘ&x^#)AKuk)b> E E0'.)wE$06 |ɇxhOtBKg-ff W4w Dolczʴw ]7#gN$]!'@ ^\eA|Q8!b t b}Dbg-X}0=D*VTmX@K,P`-X@ {~ϛXW~G0q($>s6I! E3룳m~-VқOf!ա3q,K Ir7۵|^GW\mq$$93![E^Kl=4̵@:Oo@pd;+a7S};s f_}pFp?Rt2:ܞ0[!,H?N8YVQ5@fUVE',vbs̻ H)/OocVp?/n!i!no=f 0]xScnd5ַ nbTML/90 RVupކZ{>ol~b<"4SFџ f=+4/аv@`[DaOrcmuEC*LN̧Phӗyqݽ#MKamUοW+ ^q'dG<1UvrWfSet|ќ‚Ę7@=⽎C/Al;˜s-Ʋqn6}$W4 4֬ !i$0yU6RA #Ifp]122w[l9J` z<^ңfz=z=H:= =2.20hX9aK *]A&)53's& 7$1g4w{6WcxB2(+fzF # //zc=g!wnO;Cոpqύ*s0m-zsKl@ [d5Ʋ_c2k"LTDL͡7ﲾ 0rz;34/. Rv|zO|G'Y2A%2I!' f'̾|^… -L&幽7},HzA6}^11[#($1`",TEE ,IޚzAEEU baC-RG'kaˮ<*:) K'f?g EMR=PgQNrJG)l9Rz$@^0W!KxX ' zbB?''I#ïEM'zUdً*C?'dc1 0β rl/:(aF, .ZR  R,G@T(6@LHHWX*1`,҉#џ.Q@xnfo5~h;]w钼GA@2v Ɍ@0"t5d/)rl){!,ogo]ut>u "KU?]v;{ jk7$qNCR|܄RzWO;6"zҀ$!vP1F;\7O0rJk|0[uoiM~<T`,dR,b"ȪX1QT`,EI v9?^<)O:"A j7J'!S9 , x>次%K 蟣L3H,I&uqIFdߙ4Ճ:,}d )+*`i;,R's(&%>@ʯ՟7|flEOu PI!8S)gMHgX~ )~%KIQb !~ Xv8Ƙ&].+i3m"((pVsMFuSb|(pvٍA Y %C 2b?:N)ʣkQGИIa  FO95Ta}Lb OBǰ>Δ&kpv6lI(P}jdX Yl~ < F:tv@aK#QY^#27H}%,ǚh~ӇŽصk[g_4TO8n_:~p!$ [5'<46}"eM F!.u'7b"hJρcRfny{wnSqmru ו6hiмک9'C$dKhКS-}ܹG/Rz Oֶ~Ի&;O%+*9lKC=0?HZ r!QIH\H$VA7z&y='ghŧI#O)/nFzWqXnr g}t%؂2HSLD(ȁ Z#\>GF8k ?~z7w;Z=A/*F~_xZR-.Ia^".X"⣧yL%b!ʁmQ/>Ne+G=)FNhz}ȃYnLNgv0RdZ7}GS?GzC]m7N !vC#*"IܪU%ʿP%mf[l&hzf}v)䋹ɞZЮUXk޵bCtO$S9 HC!Wyn1ن)gM $.X ٴr4OҠ6L\oY .tIXti&`,a -s]5tvi REz˘"AYڰ;],MFa |6_Fdg^y·ɱaD@x) *!BOu+GpKL ~YK޾ݭH.dQO)zNSkaI0d>!eU)aYke:QI)ɇbU鼞s^~ `_)_Ea9T@-h) 'r{(uc *8v[\{s٧Y DIzt"PmĖQ)%%4w05.(+,X""*"1gO#Dt rr?*U<`C~}5JaҙFNRa u*ȵb,BEg ,㮤9 4F(2<v%rX]WAtꉃR%ia;g Qnj*PԀWeHBHn-/8DR ط&lH958yɊ(!&X%:h$AKh3C6548KV{׵s 'q=¼Ӥ|Xe!DRƄ?Z',\Y e!rtםU G:aPݲ4 HCjm) T*!6u2zEeWԁ_>~xS𻾟g{՞l쁼YIt);J/&UuTײSτ71y!$S(D" y16 &aA: Qt_tt'>rrG!zDa(Fa)Ӥ|xn=by~s2ve"|K|?>{ dHb? ez} {`Od1ZDJK:B+G|>u5Lí#]p<GɹVAr8ae,ƺj 9   ,]=d~FǤg9 jߛ4J0),P=htۗ[2#I;za}jig,M-S}Vof,"!&T6+ʡ8(o0I _#ԭ]JdJVΓhG !,cZ3[>Nݿ |>{ـr\O ;3!|Bana]E_gѴcl5f2|:|W?[w{hju+Ka3S$?YN[k* 4[^p|ٽTg_`hbv,יF9;[:H?xH~zH ?#ؒjb,XG븳MR+[yB ,](foͥ4]]U-ea518[6o3IY5JXXpЭaR[meJҭ4`䜷5Uwx+f0—E[h!XTD $wj=,o$GV{\.0~{ R9 *t,m/*I :fX[ +HG b d!~N!m?_pn 'gDdDEH/i+TUX( T}PX(Xw] aX!#|ClhBRSR(i5h7ٿ"66ll5V[ZGЂa%tCA+޷E{@ACfA;F$;w`(}okۮ~.+8܁:\-si#bV;*kM )|g'`^cybNrD w@"X,nLrPG4Qf;h&t[ʄtiHë[`6HhZ zzq$ tMu?-ú`z9NM% Uobާ/\6$Œ%|ۡ {ϴ1:J$f(ZT~ Xj 8{$CR7%aQW|Xt|ӕkS"CB=6: - 8X1"S*0fy#a~ "8Z&;*pxNȌKx 'z?oSڋWwmS#vmz{UQNaSǟ}5ba&YjHjׯ?硄I1!3{_F [eXѮCc /`JSQ$j ernE[s[Pt_GtD/DZ`,}euW Y<޿zFlp ^7yߗ}nINNI!&'_S؋Ğۆ!cN`"CmުYDBG#ggK\mx![d@  {+Pw>?,}-\;D%gt37M K7?L Cn>Fv?diѓhĄ 3H03t.@ūv7) $G3D t(|M?c?g(~XPTP D-FK^=G~i##n$ql۟ G*+ ݟX)x&׊F "o >ů, [E4\u(LKŚX^\5H|g=s\Ƞ+L$TQ JP,aڅxتIiyH !@?Ƴ9[?l[̮ Hg0Jˊk.JQ~ZOp߁˺~TLXse*tk,bRƏ]%5z,َ٥~i#q 7P%p59NSyroD]+-uzSf@pIjs;΋& Hac!s[ʢ4lWA6ήC 9g~v fR`j`ڞN6})l2:=wBOY ;0 ;jsU'݆ z8ʵ<K-zh,ݬgޤ(xC0BQ!WI") FK9 hKHfyWɭaxfKHQ/Ұ  %OBQR 9{L6 6 <ρ%;A>3” u#?U?X,KF89㩖 e66@\G[m -BpH\kǃW#\Эc[^F7zen~.zqBGUI#};ѻ[!\ilNc 2D!%@b+*{!Cc$0ǽ+$u6LTZ*K_xSX<+6vDH>zhXy7ЂL햦ic{ Tn(xw]477lo@Ⱦ'Lǎ@(ij$  ;%'tv2:8ddȆ +gGqç;km Bn&%7qS8^} |1A +ߞD^*0+1 l'Q-)!؎?W-^QL]H ?g{^iR}GO[H#!QX>#Է-Neco 7JkkmmJHþ,'yѷL4t}?9@SmadKw\nW#־`ˬ7l$mx{i1@2dA0f|]v~j5?JH!"$Bbv*=ksg@0526 7MqĄkMB `dqcc EQX$tR-`xXCm4 Nxz- #Yق9KUH`{N <^wXAcTbUBA&4G $n}N% [gWӉף:>_"D)$[+jPLfO]ם6b6{z~LlQȶԸrXJS]!a t{F=\-OGa @B5tܚQ m݉ 1?ى“3r y=p?6<T7e'o+gĺ_R7KIxNjyR ^RonI] Λ5s^xq$t㒙@', D33%58f5cc2swnb $/l9Bݛ.u䣿&ĐC%I)N) d'3S=QgR~5Qң2B\Qm__ ŽՊ"';%g(Xr #g$(* jIbΆ;PN { oN Wc5H-z~Ȩ:efț QAEowi {~@` ~꫁]N@F *B v k 9A:q ߬!5-x??$PnLC9>D쁰 ބ351g S^P<]3~DQdEcDA:H$ }\9ڇ/b4F#sf;$q߃wSe' a fvu}is7 1.3&jBQYsܰ۫zw{M~MO"Hj9ǒv<.2?~:7MV` Lu#0B7W,Qj.a*$A8I* !ˁqYy/L6D{-$[Dgd_r7c W(P򙰔.Wj˄e?[PfVv@ӐNa63pKOw3L) " F, ųb&u=Cy ؖJ>7yvQ"UXFr/:ѼGoL$cOBBkЍp)Z@<-)7@4ζJ {ˮ KN߶rۯ/~"U{vڥhq{g ĕ5NbXYz/(,Є,3ҵyòsp@ }~a·s+ :@ x4(($WCBIvq9Ғy19!P5<[F֠tel}Sɜ,fTFp=lgyy1Sl,*(/o?UF E|{)/кiRӚ|h"e(}xfdF@,İ$ԋ~G+/xj꡷t>}&IGXF!ȶ΋w 6yF2FIJ$o^dd`Ĺ LS$}d/{R}J{1D:x$X,̳qL_g ;7L̅""Pr·/CBIX-P4Q k C}#BmDw=#.P*?/fʡ1i) 1։ύtKC7}lwp\30:~\p'`6m= V:4 0w5AQ3l" <}7_#[\xH,IZ sx6t)u/hB$K6$vkiy"O$nwFY2tW]>NMF$o\oC|*u _ܳO+dXhtGT Ă2umVtJ2Sҕf 8ܬ`@݋?CgK]P'0`|E0Vdb.5n1Z R ף_^ʊ1J@+D:D@@ @ɹR`ѣadbjðu~b2LHˑd%$C/wH$v39I,l~=!iLѱU#(x緣nN7Nm=WF LJEwB]oMߠ:Y$w3am{5It!]E| TՀ6’Fܚn3!g pY`>YWHD7]xH&c*,xU`.KNwMd1ӘePyYnbtY@Dޓ7.ELzbaЗ τ@ ]"wZ£1l Fѭ{9~0+8D ?+iOG,~5 V&W) mv0$jilmQ$y;S#=|oЮv> {>Ҳ>XqB hC⺕pkخO{=[e> q B@QAbS5NDFO!.=~??,PVE`TUbU XDQX"p:G='?_; X2E&-xܫKy; ȳ_ Q>+S0Gqް G-yrV՝4BoM7 j嶈x>⯃US?S4x5lZ3R5χ>]~EPTEQ"8!5NA=d"Xb**d4shu /!N84- +q^BǺ/oc!$rrsY)5MqW1HburHV: :<.Fu+Y9aY6J,p\?PP-rB-HV7,thIiV":e7mewp_=ǘCK ""Ai㾨2^K.'\FgxGzl h"-ʡxBR pX"y[H  )̡߼앧iX cRH,NSQ$P[t B6p&Ȑ z\>a-3KΣK#I 0CgۻN?AfOXa0'+,sg,f}s.1̱u_,fXǔ@Na8Di|$GJS ŃNM=k quW@(kT&zGױ^ |R'W FmI((s;UhqR1j3hywS-qW@ \?g1yB}5Kq2̃vV9k Fw#:6<}0&dN^ wA nH:`h2F\|IIzvw#(CRwX>z#urv j(7VE$g)jsZGz4ȶ\nVǎ5$PK-!rɤA{ ,$A;H Piǻ϶#[(:>j^89鴾9͘ߪS:CzSLr!h4byL@SUFZ rfk%6NǬU1 |%0q@S ۣҬGU OPM%$ ( 0u`ߎqO{my3#4sFʦ9LMR˴ ffetW忆$_gEz9EZhGٝ!MvjճƑӹ(1&fՃۯ<>ev;ݑݝ+A2|g \D9nu瑄!#ߠ=}7 4M'MSfkDޛ$hOG~&:"d-ҿvSfvBH>vpc*>jiyvOp{|LݥBlߍBZ.ʸY=_dӂ HM %Hkk^K_c kWUPȅʒVbmF[2& 1zT=Qe# G@ h23C K/ M|VE`ujó.>*!IVOEK9;jʅF; Ũ 2zn$rRP^V4ӉG0[Ud4Q ?@ QE3e!Gr/mhrsͱZ| \+$ub<"Q 3ZS{ x^ T#\U%)<,|­z|ܤQ ~V"#ǺxоHz&yWծL| WWwȩ0n UU NJ`sȩ7>jNRxͦ ,V~d%x|OL u &â~'x3B; QN-MTC4՘ঔBVА\@6Q]4;EkJ7qcV+  lQ#"Ne6Dg";aU7)0iwa< <#߁ o3S^@1ĈAqܙZш"c04aFvk?6oN&D >UǯNZd)_L_UJ|ggKr%E^R&w^)jfjW1vF *)SyXqCiK>d%cv4* by&Q c~.tw!ߪGakD<+yԡikzv7}H&Sk oMqN쬈я'V=彼ʀA!45CIK}8E|^*@+Ч0B(u-O2_C"|!ƴpR.0JAm = r! 㨧?^իTbs@|pN*AjNV4Hݐ "eCmG!) M0 PK/Ao<0E(PEJi b]8QCYA$P/mبހ+R yv! "Q-x4gnQ<8ވ)hw.PTb$.EҡA|XȂDSNA0m越=l+q$P?(@MszqiT

tHȆ^!mPjB yX"g *P$QQX!}B@{Z}N c aHHY c,dEU$a5Yt0{DCSmWǰosgõ;"n!O# _3{&yU쭔8FFV^V ϏeʶjG$2mvQjm2z(`輦NLT=sg?lH>!"MW_^ƀdKʟeh %HyUV !3 '6Y";h`wgqaoH1(("EK@vC(ȊNz[Wm$=gPI0D/EQ=PBP;jD"Q@OЀu@AqlKBP$ۀ z//[QJ(tʂ(b"TPmG&" A(wQD JH,Q`X***E"1`M+|d !af:i#AX*AAV誀B( 2 ʅ2mRIPQSX)EDaQET[DETQEod@Hp x@-B(7D_TP*(:"(XX aFy X,DQSKn #V Y! I*I$WEm$E $@$pQ"F "*F"c"(bAV" b F*,QXDw"((F,"# $@BDEpbH)U,db Ek&H<ѠtA$UEDI[b$d11FfZ^` ȵJnaGg4IZP(*d,U"a]L$!'f2, "D,PY 1H*ȈH*@Fc$I_|F8*(*,!">KQER6# QEETDXA"dXc c("#s&#(DXUT"H"RX(H( E!V)R(B $"mA`c 53C@oa4B1@<*Y_A ûhHK~ E^0JwSiA<%Ř+@N(V#JQHi8"*#XJH9<"`ޡĀx9{N`PDY X PT ,dX(Ƞb T`")X("dAQU`"i:#Q=5| &|\H~)HIQEcXX` (*ȱŀQR,AEQA",AQbu2h":މlƠn}wJ,.p; >2w,( ,,EH Uc"1"4#a'1zoW)$uALhxx.(PpxIjT)Ri97d4\ib-'v|2CE Hl(  @$2Rh+x"ՁaZĿ㠾"()QT{!!:*URDA,Hs) #DmUC",(Tj*ωJ TPQV P "(! 2* @*4$@0UD@Xd H!XD$U T$ABDdEEYDI$$DTYPBE( DRb2*Ȫ, " "(H   ,@$~"dAAcUT * " AED, H @EIEdEA$EHAdEFAD(5F@G X $PRU`H2(tQQZ " " "+ 2$Ȩ""(R + "!dFFA " 0I" " Ȁȡ*! ($ ͵IPY ( B  )hHL@"""!"0 BDF) 1c!bB@,VR EPXP! aHE ?HT"bXP $>QB +@D HB @#@H 0dBE#D$$UBA$VOJȰYd$ PH#@D0B+b HT@HI! ) *!aAVAd 2A@Ebh"ȋ dc$X,$XH?YTHRgX`X$HB aFA$$c"HY Q} *$  ;fJ!E╕dN$.Ozv*[4e DmǚԀz=K~v iL͈ s? OſES$dv]f'Y֣l?ƸK%(D#%ȈlmZ,eSS22=K w^0 S$5KAb!vI0$!Y\IC֨Àrhs~7u>F^Y &yPG @6+3cf.Rr ,em(Rv1`Q Rvc@SZhH.A^i%caܒf#,*kעk$4) F K4@@顇$}Ѣ"Àǯg@a Li+9C[R)fu[$f'w!*(^$ʕ̰ރS᫓df(F<IS4o3;lح񖜐_g7x&g}ScV_xr ,Owg/9ϡHNlJbI !m3XYN?5LH!0qZKZJmKt2c ,Ƶk`9n:,R@@:(PiC(gBTlys^*)0zĥD`#)@_ϥˣG#W}4hN,G)`f J6oyȢŊɨQU} Vv( *1lzWږo:8?uC1V,1QUA, f$:cSY;[jwiU)rg рZ='˵  jBTr[ %cnc;>Ա6QBnW:-T<[t3f{NC;0HH(#P1TS:iNT,=?c9<6xT7| QDEX1b1ADF,X%l+"ΐÌh=}Q]siH1wSfpk+\& tyʏZU6Ikw?m+h/sq>'~wj**A*#ݥk QUP'_G?/Gt+QH,E"{LAbQDXg5 R. t vo5^9;E$C;)] -ϹF[WXak7"" Jųi Y?=nib1CہQ`$CB 39=9݄MT$"*JuD胨زy# zıQR,EA:y/oɋb N܂ up WWwBkXr2x/\_ |5'_rѶ?cۈ$(`(bxQ'{L8DF1E#R{wxXR|EE:' Ӆ)׸`A҆=SD(93gdOޭRsH` + wU?HqfN jC(,+}q"(bŀJ2' `EEUv( 8 $3h XzWy:ug3^wa+r6UmJ0uwn`  A  c;{\z6n+qE#dg-=gy;$ins%ޝ+""BF(X*R5 X(( TF Qc0Vs U |-X3_NT`"HEP;Qbw("1V*b0U:YQbb" xRD!zwi8͒H1X,`X "" 'oQEAbU#(1*CZ@W`SA![mULɊ+['EJ NOM L6( |ћS~gMOtETMڠmϚ,Vh*j3tp(IN\DEQ)vNOW ߠEE9Fy\nwڥA09XMgJ/D^.4kзlX+: 2x,^Rc0 Zyta5A'uu'mLRl8̨Ƙ:k0-t=*'03 X}6*^YiJKqe]Y̆(NQdq u))mJHnQz% |h@fUu/BE`ל>oɠ,u>)b }@UE}ʊ\n&!T.wDBAADTPH(,X(A! IHv&0L4P]mOq39ol !st!+N*i~ο!HS  2  "1HDAQEAE" X""!_4=_<ڼhgv_>x b?%ӗ }F;]ĻA dI@IaϜ{]$R@E$ ,X(H())* "(1QV1@V dX,$wD`EJ~5W?vzN{v|ݎq{eDAB,b  "" H!$A% suSc0kǏ;PAȨkcnn\s NA@9&jH$/ ?b 1n*էf3$dKT1YlcÎnz GᯁVQfeEFb4Q-Z;W/ydN`QTT`PE#J cb ",H"H*} npE /;ut1j)ZPo>P:4ᐐo: 4^;cĘlʮ )ˬJ0D"@k*yص:vɳ@Y(/}kǞ}RMH"c#Ϲs( `3g񺯍~mahŏ+;S*t]bP[i?m++(CQb?K:/Q0iԴ*x r3o B+s+.sfecӞ)f=}>4).SwM8<֬cmRz,1nlT|{WPJsn_svmCQcJn>b.+1x(Xkfb޳ S1cBwq !5l /sÊ(tPSjU T$DMJ,zUA~GaBm "@ P[J 4a۬q~v;=DiiDt 1pлHPEÂ*P }h aP6<U6q?y>&WV6CP(kD! QP{Ȩ GB*s:tFU^."9X-"ق?cN7+1oM(hoLp_ň@8?S ń&75oG&3Ң=lPSйAKTs7 xƱmQF/dzUB⸂2xjBvxvq}^`0&31Ufikr8]v[ ߗ~fDr4pR߾LKu0"3iF^GJ?|tgӇtZB5g`,G9xWS]h[YEZJ!U#Y8џR.DD|¥_MOJvN]էf|̴)\/#1;gyseCҼά)ɳBD=%l2.8Y:D5X6eNgK7Ebq`N&(/,E{ΰMK8 jWCBgg-dHVT˼%qƼS+g}~GH̅m78k|"!jVU٩\9uIy 8Xr`|wkSګW!:o𱔑XƫHB򢀼+|ovϪ-ʡ*AsP+Ec/hMB1B q:tY:+AcnW]eOR]ϝ4+E~Ya[$ZM!A.~je2VBWq~.ӤLTrQfN^q-EUJLAAj'S?=`g-Agmh"5tspܕ?ugf / J~+2g s6ZCE[`8t~Q`yyqijrRvL|O:*;ފz66Yj<&qg'^f\B17*ԈȰ LBgz'Ea*4!7Tikq2_ubXuu)Hڇ:,ԥqr6YVex QS3 K!\gTAC<е#q'}s=LT. pJpLu),.`zVWvr4-5O U)_sfqL@2B;;٧EnZ]׿2~L; lRſoܾ'$$A$W{8|}~Fq1 wDTȺ$lȘrL-:ʎZ&$Ba9-oVwRGZCPɮ$6)?dMQ}[ҹy>-X RwVj%ɚަ8Dd?ea韈@A-_Z$=.j*Acs,a2ص7 tC7p\Gh xY|i|fnJ~;;4GŌ>&7 E~6GgHDIv=ƚd_^??NeICT O[^XvXklЊ`撆v)I-ƱQLh O=~(x)[]#6}lBЌ$8LM[*DX\ZѫuiaT&3Ev0"33mmdy@xϑmbZU+iBZ1T+miFQ-V6Њ-*Ne-"-Id֪Vkk"f3һtD%h$f߫&g殶SkUEA9+? bizWUưQUj* 1|G\fR3k1kJfcO9kͼJj]\hu)4360v#&2T2Q2Aa"%9 xNe(+±@D LYPMD Jڤ HU4R8 Z2,bJV7Cd!O#B,$*.aW5~.ۦ3Ҿx|=萇[g$َ©amR\.oMf~ CNmn ?@j=g4b}$mk sD^6E$G%rT80W)z{w/%""X`8_ؑ܊h&eF'$2@{ ;x**k{rɊt%to   0$ )HHTH,T;p `x-D)q VbQ6!p2*R``1B\ @AO۵1ϓ\/ )!,QSN"VaW]# D v{/P@8 {iǀhhg'a M*@B3R t` ^ dF 09yp0zSƋX/?IݠOb1cMGYLG .#T 且EpX/,aJ^" U{gĤ,|R#ct‚r!gIYo1S~0J=|f_td@8b.-ҡszͷ@  )RECAj pל7 ce0?|Lf{  RU݂Q7 Wh:?̮LiaOˆL0!6JGe)6ptuS4vJiMeMy5aS0=yu-[iψt ΃ŠC}?65[|A9X`ۻ#H p[pz,K/ɏL>>: P.T9֠$"KdJDR!MwL3IhUD?úK BHD$\T0Y`*)EbiAN:`̈́eEUYAhkQualْi47zp]t;A*zaНf1C;Tfp۴$;]ﺪsTHUXEXXdX,'ևm'/h NOj37ƸYLu/gw2r'i$3"xCx Pئ !Cf15ZNw΀]E=DRj_moM!ml•EU\M!p RO>WoL}o7x&%JwkixWaQز,,>n7q Z@{h'Pf.g7ͽM[Ve_Wb^l| HC9VJIEuEB%ghiJxS+V7~ eGB8ue0~w_pFGﺪF"xA"jvԭfl},:>ݣ>_Y^ŀ::$Ѻ'"E+ Gw~9u.K裉8U}?a{eo_-Dng?K3t.V\Uo<+AA%f ѣC-EKG4dj!_7CJ?(6sڥ2JdJ颬3OZ]:دn]ޕ " ; (@@3 AӀ)nݮpB~V R|[-սDZж_wiIVCVM!U\MrZzP_ә))rmb'~^a[X/>?p3/G~(4G˭bW+ݿ&pX"dZ`8bm;x}EB6[n 푳ֽySkp5IO3: ljǤbk{FTXUފ8S> V5$ti[wEy/+G7D  0Zq^"mŢx!8 ?/VT/j>e&9|Z֘"Zʻ +2\7D n$YOlYD;`@2/'s(S')ώOA XE(}mX(CᥬyTC6 |ǽ˓N·~9Y7wz\>fgZdʒ]X|+\(.h1MZNEm?i 0d*Lpn ̌K ( q ;E`,৶7khn.(0R)}o]wӦuV0ib`|=-:gtoF Fw3,ۼ m9[?Oٿ?a=keo΋%gp+SNQI gI[LerʳeyJ/,f'hp qvlE:`)@ Ō\DJTki.ŔL|R`$`gޫaMNS)t 1>&SѦ)/:0+NID*zbf;H錡ČuZ˪^={lf[ ¶ZE"#,":{M̫s?cK+2glg:5v6\Drl_$P1Fﱾkw O_fg=kspM582$cP9]Q5٪v2x>1ZcZ qzߑ::/p&ƃ7eS^ Pϟ'%PxQF-WAe[.N[GXi=f箍&nE1~iϬt/"Z4XZR>E~YVLm>.;rK+dH,v`ZLMtm/][SUheضmk7>Řm2>M'0v /!=m}7^O>g_ 8R>.Ke_ԉ!Uʃb꿯Z[y|̛"m{I qj2@x!07t=0j~xIk 8p?W_?ψ0to4PBQ& !ًnpӾצ]Ő("@@v3c^f؈ " PZ[-x =E9S"Hl0yЃ?g3}}-ᇳ>}'kG н /1=eO._{<>[NDUKfqzef)UAF 03~[[f:ڝ#m'+X h010SF8ޘO_JǑ-kg{L1{~w93yЗ$cڦ}Jx,И56,_ٳ;-F u{Ǝ e (ܸVvVk`vNLMpQx"u=(zȅ]D [|NdA7/S DѓZ{2CmI8QB4z{QS $l5BEe@w,pE tСY O$1kFЛ#p&6 wy݊dԵa fي`H,smCL>1~o9Ć|h JJsqЋN~#r T4L?DVbā\R;ms嶙m9P^HVN.FݨKTKGNۙcmx/q.F6/}ǎ\uSZn&([XƝnbRiN`X),6rW*X * $%d=>F5)Rl*)J%S-"d?ne Ą\jzX!dNNvsvu[wʎɼy%r3cVky_&wfRP04. {,r;:Ka_3^Sʻt=εMQ-ilĬ~f\$Cg?7$q)i+\X$deQm_1X,P$c4 DKj5CӂuzE>eyE#U@%/ 2 ڼtpIso|!]v.Bq6)~. r!z$;( 0>|JG**j@_6aegE4Y&5*aHn^L8m/k(!ϥ Ay ÂmpCKA433L瀲 [c+:?:j#A?ಉrM E^ tsaͬ0%NSI@l:`] C_gPʶZ6@l49hlW ^>^ ?UbQzIztAT 4|a{ yH8^xe/tRHV!~`z4 B =A\G2V`ށ@e3z\\LCΒ $-BgYlJDx"3MBJPP$b+kE5e1.b:ԨC;S7qIl<7iohPr :9{| ` , =Sء[\켝cR ES\<ߩǻ+zw{Tw1gM} ϳna*UrB}5rpX].Nj`0|νMu p+Jk-+H+9~vm굜ta݄akGo}9ɹ&5~Ժ2l*-}FàilI~`[X&3wϙWf҄{"L }rgRl|Z>PAA#.Up鉩5jZNBpWj#׋/>)>QA}%b.{٘ Oԋ(jW_?zWW? X l&f[A"U #Ͼ޲{Yթ~[_qP2?ӂ _"$P"zE@}^58֥TszrߍWG8 !0KE"tO盋(?=6Xi]mǫ߿=5ɏ,W];ڧ5!:П rq^lkWyIz9404!6ʳsM8e4)ቝWsS˲;\ؽesMx0iL.!e2}- 3I Yσk~"~ٻYyJR0Q;=x= җ ?dB$ZhNXcTptj޲9 Úpd" C-Oa]Q&]WUQsK(BVA8t0J ,7 KnqְfX*ai+V:CF^t _"،EWg+agX\3GTUzt)YРMk-]2e /a-FQ1Aa RI4E`H3}P+)b!,$fQP2(DHc B)Mݤ4!M6ec[4@@004 sj:jPj ,Ʉ"'MoӾfl*U31Ɉ;hjbTt+[DZ+ mcv͜k M4U[g4ņF@š CTN(\ilH(BhqRc!K՗nb#ɢpr(<0TkC9:x xdy= XLw:X D`a/C"Yo,/ {I^cL*#AKhήpB|3E!"w*fſh[׶ү3DgTuZv ze75 \-Z sX L*% W.xa]濛 JGwv\Pc-[]$`6YGnuɕwpʍ{ɢt(x֓(BwƶV‡cl˲ao]͗/h17{ҋ6ck3ުƏ=9; oHeP[͆˅6jڇno HnR1x]]^Gq+t6\ڭAAЃK?S=ן/w>dx15 n;]NlvڻHmv9TDŊ~z3wjQ1^ꋞ4@{_z'r[.WFd˞'}accv:b%8xDZ-IQ"6@ 褁Ḿɹ*?wn(PpBy)B#N+3G|j9Q4m4 HfdM`k9i~μsǥ~| )\~(21_ou_u71hyPa9z,&qۘ W=}?4pp}C[\_{`ɞoqzGCDA6QW c$o բDs[XkhIrۉ:Uآ]JIc8R:;d#~DCmjHA40RL`!\IZqF-nk>|i!$(@tٰn9+Ei3uʫÈٛ/C|)/X>z-V-Q]HX6ESi_A@`dEԁt4<WFG=2g;HAwV Zb['NcC̠s\ K{H%ݚMoP0601vWsBF>kkQF֨-jh>mY3=d Z[N)%`&4¤͘#E4ŁRRQAD"UP"1aAb"&֎_m$4 ,MSPHT"Bn|S/G#NW6`L`HQ5~8\SFhCx{~'5kZkb(݇cn(^!CDC?`(L&-D$T>d~OacTOž'#ĂPBEWﾽˠ4K*Jm'/u*w>em42!D /`>c"c3raǵ\X3Q,ڈ,r͓zi VK`|<;~[#Go'´ Ң΢OE^~y˺#RʘƎ1p!19}~,V63eiy\ "ReX֜kK3dW[ R`M=񁿪f, bcb()ߖSmc]9eA1*sɿ8!h~edF Çˁ֋1mů؉^yEym6QCe}M⑭EtBU31/_cfTś,,nm&}5<54y4oum˞Ok^g| mmѧ;xj=Y @+gL3ӒO$13Ae#|f"6Sl?])s juqBfN_i~__*iOsd -f/ڞ1` Do+E27~ucf.n]ּ(yxN诏3):ptιJ%~4 vg;q)}5mMRNӘ=+}^gjٕ'<|XZ< _8?>GK}(շL,gNq/gNGbNCpexꎼ7l94 PQ406M^ICR1Μmžq=y_}+DUee6A Eѝs/;? n2ѧP{>#% 0Le|$yGz"mW(k bJu_i2:Bȯ5‡umh_A. u;xtVCI3X]w376!sҡɊFdqJzfqjT`-nQz'ޛ\muB\$]It5m cMV<2ov7 w#+sE"5>O_[*uߝ>>BL':KKs^|\^mWa,k(ĵX Ͱ_޵gAsb!J nƔކ/[Ptt`-nVA!<)1zɈLZK5y:3-l w6_zcKQK&v;UZ Aw!v1AiA3Fxf Z{{3%I A, xd6Rs*|f ?e%cϻ޳:}+iYG{Z +y\;vÀ-4LԚ.?"ad"2po}(Eʋ 栫EUӊ; X|] @:B~-΅nN?Mꦥ8 /UimDY)M L[#_M< 3;x}a?G"T yY-i2)N6Y ^AkhU}I6۹זBf^塊FAàfbE+c#sf. IGh)t{ouX}cu5kf0oYimb[jn+'[@.˱Idk`t ZZ >f-ZE#Yؔ",wo3N, '}&cyA"~[Bٽ6[eOP3:3saM* ,|jh>( e)t:>Ѓ'Xwck璼>ﳏՖXw)=#zFj-VlՠBO{gc4vֹ]d1f lOr3}uߩɯy_2+|קXQ1hsɸsy."YŢRi=~rQѷ 3ۈEޗ>;OD`RIJ -]$]?d{/5"˭3H0\D5[AZw} wxmb~wf((M9i,TuHr^4^c!miK1Hcku\|8z ^@@<ˀ(H*x/}{,>=U|'X=okSݘ"dwɉ1t7~z!t^[{ۀV-EEI )|ֶTܨҍ#]<2&`IMJ7SOP͊<SV]t𨧕I4k 9|o'pc[\ynAs3i>{#Sl,v9<ɋ^Om"Q:X{$FOQ Noz%< LkFhLf#h@j7mʆifd+Fێlh>b@b`d&!VI/! @hL^l$&(6]@q` 0uai-u^^BLD 4V:hbp6/եlC d e7OJu4ƲPgA[)or @#.Ȑ;f dKR|b\BA :~øe^x>uLp3Bd=t'xEV)M\<&.݂/ZT:f\}4XW}NT{-1r V+02#n)&zloxOY(hӿ˽SMg%M&o^Τ.Kv+T;* oF GAŴWrv+iczݥ:>CG}HѠNz4ޚA~*k~Z/¥"6g)؏XVS069`уZƫ ?攽D²+7xKB3RÙ_3Jup݂8{hg#T| !nͱ:nMf]sW - u)&-)7oP*"F҅-kcq3c6ZmuKYt!X \E9#K9Z}/ |͙+I'+ 2\tY;vּvW՛yZ/_#Rq{'OȝgCW[B3YXs'ئNPB88pSaG~m}LެO1'|sNEz*j'P'QO9wp뎢O}E'Kmz1|'UN0gsЍcnmzVSp1z ac:8`G}e~y2`pYq-sQ9=-~DcfGo~]SMV4Lbɓ}ϟS*\}.0cOw]#cpH42xc.dim;蟻i?۸muvz*m`'wG7}v%b#rOEWC-.A{hյK:Le8(Pny~q3KgsH+MNL[{_`jɬZѳ:m&c4H;u5pBFqf=,M7U49O/*ZBn.v-/\qW=,*"o#!_u$ztFUz h;9H]+맏cp1]?rB/w}XHRw\iaI G0En[ҳF buz?W*ʕi-}jq~Kv<Kt+%.޾tlbS24G& B8W$WE|{n/x]瓤r'e Y!Z5B1O+ѫLjU1+!l ̵"#^ߗC@OHEMge#|hfqn K Zwq`zɭo!!daeHXkX$sȻ,̋SyEx0\, GCy*/y&px4+vR虫iuU{VC9 /[YdQZ. $S"P" (+5( FJX0ӵԐHA CADޠqjJ'KDv+{ gs%.hIsey$uJjesfU4%|W:3 Dhyz^vύSb.lHCwTy:tb89:FeRA_C՞Ssng99w`7BAxqL!!bp* |v=6ZreA4Se$ A#!|.%-O9/7 LI 4oTƏ<_7RY%5z Z$Ax\ڶfe7G}/mH-Dzya(_ax󢼵xX4YbK8}_K^fSչPc_OaS=H`!,QS#} Cr7jb ؿ@Ρ`x{ĻRSLi#:"r37~׹A.@V D)ߏ}?yjA{?z_aVa1fH~R౛^{7nT]x.Dt#,M6kURX1`lnqy`ZPfi ! 4%>&MQ3;;McA}͓{ vufP?3ˣM/n0zj;Lj?|{bwc~r\MX16 @_DL>m]q*65/NDD͙Ds8CyǵƸLē; [le2c(A]FKqЃ^V6{iІ!88f,V\Ӗj13 -[ka“+4ۙ ՟[Kb- ,(k+9VӜea2 M#]^n&Ҡmwi?iKsz;3 }yTA>ΎKcȡ3%迱̷I(Ta Hʻq+c]G|O+7ewVgT10P2;5Mba&7G|jҰI߉wlxxoH&̈́1Ab!i\ MeTs! dA-r}fUJԶo 8|Zf*&F0a8jMGK-L:옄AOi5 6H~$<ܐ_2)IO!~O2$$WkJ ŎK?V_ԅ{?G"e8X/KbV3%2;UHY hDG}~Ex9*d` 2=3moGٿ/ mo}"xKNǃ 8>=Y/wǼEre+хFI{H]Ɏ9gM4czvarÛqs[WZTrIcHɃշ[ 2=NljtMk6-KGPcا{۞ K|5t7w7VӆEY\V^,X0v5^ύnE~׷ėV^ח{oiRxpy{Ck6y^?9F>&]WeϮ2 2*/,dbJ4hvr>?I7J?0AA~mFHHC{hں觼6qm{dJLY/!lzr+7[jò E>Z[v/BoքJUX8g׺ڿk\/B{,|?ڈ>NyllAN 7YI<4^M8['$ "\2DSFhN%Je?_S*Hj$UJnc4Yltmn7l,?Q!nd@m;< w8.g.Rqxϛ4_0\('ȌB ZPX5o9A"YK:EwOW ir &ؠ"-Ɉd@o+S|Oѝ0%x\}/-3/sgO)iY&zV gvCF>(?VgW{ 9Y, o/[*b@6``U4"|=¸+]b}p$X0!K43n0t&Kh5%ol *CmKMcLV&]M3 63V)!H"9|ggweB0uw`0-eKE%]mocjORzlzoT#Ϋ4>Uf:36f ]Zйp8HxdZ&i鲬b~ n/B1ȟ҇򴼍S*]r>wa˟*-AIJ;*  SXBu$d4驥lA%)ŷߴZyIgͥ>k mU{CҰ{(䠹22%itꉭAk\᫽w얙_cѯa:5;mn53cVc^멍$Y@j17e",яӘB7:#-ClZR*fأ\ڝ\r94ϧ:2޴]:S~պ&렐RՅO+r b@nrO1M`K`XB:h}qn>wl -OLJu/Y}0B'G(jLY&i*;?)At9jIWt) }3RrUlWTnt4™16bxO'P(\]4.yP&1;0vWk]/m".}¢$e0j s5وC6C]V/=xry* җuZ/[Df<ͯ+@]EG,Ä"y|b1&s)r31xy*OJ VʕLX^vV+7:vE;BఙJA)T@bڛ2vaiHJxm1J,Z䨞j׾fv6֙X,朤ETZH\Xi(x6,^&ƃ[k{h9O%Q7 t Рf}njg{̘3be/ 4IFCZJդf7>-g)ݫ'*PYOCݰc:hT>\[lzd_Y0Ɯ4U% ߋ]*ң/]8LA]]Xxx9.&~|TyfmDii&922i nd1!8 X/VtfB1^T}ȠHBoPbUs]eV KMo¿C9luT\]F*]q\L4u'tҦm)65/3V{EX>UM~.I^ayZg1L{8ܦCdݽ|Ƥ:vL1eT/Y\xSB"v]wnm2SG'C>nL=!HpgoGV^dDp v|GC, lLcFH5So~/w1yup"켏}t }xD}; ̒$NsE=uޜ𮇭 T%(y)Q1|aXcH )Th\@E^HR.E*tNC8;.(.DNuH*ķlZ,C爉i0!h|ٜǻ\薿c^b/!]xp,hH:+Gj 6L~Z(M\>lUܖq"{JٱtxC(w]x5-r\I(b+{Aʞy Ef,Z=][#9}"> d$$c B+EX1UXTb+TYb"A$Y* /|l<q5 y*ff*S5D'k`pqU MQpojFj _2=X#iց*ހ!X aT8+)h/L}+ sv?6_XDӴW=I`ǃULn*˰_XHzܝ#Uws~jaCI,B9RKmpDY: P#rV L|H hQq%{TЗ>\% jN}~Vu`,:sCfKZlT{w>ҥ*92?C\O #&4%V?փ6flɖ6aOz7|{Վс9L76U(T^þYLzˈ0%Y a8]cʍ^mj.K4Q~,+LVb-إ׷Nq*ܗW lv^FFE+oᰴ9SKʌ͖v'~hn4Sv--{W_ϧ[]ux~:4MRS_3az+1{TxTS"{s hP^D{XZ r{P# '趿Av#:CX()[ p#"Mktnb"֔]n!{>pSRQH X(S3yq^+R2AL늘#]׼T(dEϥmKL%5FH%לZ[c~qUYd(b $$/_c 7Ԓ><*HCX̣щbTa#;;5Ȑ.=*c톦 >a3SW~Q76)jtSu-w!Od 캚l{ز*^ET2Rw4K>U1oqESg7jw݇ݥvZ}~zZ<Vԇ05uM%{ZЊC0I(2 ["g#8Z#%P'Fo)LptzJ(ʗ9Xlbp ̅nu[۞oN.a yե46gMsq]D}Jvo6󞿉/+sTMP,oHȋ^ڻw΄ C.@}=r@"ߘɑ !Q n}ݾ?m~ibgOg `"ȉ{Ͽe[ o cI 謋TVQ@Y 0UbAb"(1 (,QU``  (F E X(@FH)F*(DU,;+JADXcEOq ,U*X`H " (HPXF*"TE U@X"b"XPATXDd,E0AXQ(,E,b bXX( (,DQV,U ,VR#$`a!Ȫb" *U(,b"A` $EQDX@V"{o:C?VH}>M `{*uoZ$,Bt:c3dr8Sy!"PIx,p΍!"SＷEaS*^Qީ&&% I##*=]&2鴉ϻu^Eብ0F!TX'XPͤ $m Lp;^o/g)qmQqp3p?JbUy,'nQ~~h/LX'2\!~Z,?c B1d` c!%xmqdM|یUMҤ\Aa"Â,4P4jI @!jqH4 ULą0ٖ[l$݆lin o46jk 놹h Y a2l2:v;R cV`,(I =mf\;M&ZZHTHAd9<2ن$4 4JDbCI:ی]jꁳX)6jC(Gj(B5sE\M ϯ`LUL8+'@ӯܼ 8:uvL:3w<4wߒc77G <):2EaŐ6\-1IdX* A`AY$FE" "! $,ڼ>2ǘ뒫Szxdşl-?-F7^^`ଷHXC(՜vN暕*አ dfi~7(xRtw@:rà^7& )PA2 .Zj,j}_7Y墽 sQSG R0P\ byI&o:%(Sk'?"C]`1M€o^Ie,( qypPx >sU(W_hoI!$3CY"upz95X9P7P'#$/ .}"f?Ny 4"T/ZT#9,A @ۧfA#yhI# DkmSّ͊~w,<"LV4Oj~|=l+{|q9??,K7vCun>4h?$I@>F'^.d"s]:Z(@SQ1\%̀-1Gov ,E!*X Qb`0eCf1Hd8A,EN2̣\Af@i] <7 Le 8ƱɸslWxQ|;  $^l f93pMG`l }A:w&/q? w C./R\+7}r=wtj\] o,&8( =-:hʹyjfXo$ljVg:%bhi}F: 5U! zdf:"b!X8|mw O9X Cwۊ̀t#yč"shGm(@ NNX̂ݴj~\LJߠ\)sW*[k?{wFY19'/zws5 w攣%'-W 2W!2"/ն\<.j3+#vPkȓұ@bQ`8@cAJDAG}9]$eC̐ݥ0}lD3E K#5-XfXfJ?@Fcs O?יbkU^y˙" ՞>]Xp/j|^?v҈"@'J^ xseh[Z ~?1z2džqb ֑P@qR[ I%\pay`Z+niy+=HVꮼq% 2 xeq>J8)}ESdBJfUq1c4M}mEſ'śYOH;ng[<NMy|-9WH]kttd/9_Ibyr o7o5QhM#&l, -,\P,!u@qg<.^. Ѐ =>og^0$` bE:\cm{Lݴ<9YNZ(q2m1~El6^Nϐ YJ @`\FPҟ2r(VJ9?t?icPQ(*?>2"?J,o 飸p"3nG !^N){;D'{ng0 w=H.[c`22/WliPC?8ɈZ(ZT\ Lb} ŧcx7,B/lD\Jq"ߍM`:_7CXa0[7s7HSjUQG1xy}/.1i@4?R:|#Lc%>7[_V>t'LmvA>! MKu ?[}W5Y1(AW3ZO2=8~ߑG{A埽H\sL/5yVMp) MbBS7B}[y[~)syvX)o(%IS^T4pZ$Ij[A?=| 6۟eY(`z?z.[,yz#v6ÕG4QD2U׽V?;c0LڦzJ ;$vBHXk!S^>s?ٟKN*RicnTױ<0?/[/̛ږ[\<T23D&m:ʘfߌ N{vfx;i]{DHxHJi<tn^e0t#,^βDrvK6&2#鬋\g^xz n3$wEY1MkZjTe$?ftaHn-^V 5[|-Tt4(`; n`I, xnӕ3*]R' ˲(`?BZSuq@48o¶&Ų?_-&{+5بGş%70Tʹg6^foPlAQLsKSт73w2\D %8l\_PVMl>[.Ua_ ]`fHu+f'GDa `3vRΩ_ZTW| j^c-J?sI+橷2kazU5 _zB{E+Uym,tL[iu, ln0>e,g01*zbcy}nNi$Z;68凉'3z#ׅCsiJ9.Kzp̸Y BrR̸V߆25\+NkM9 9KӍឭfLij/s:wr9O￷1͜h;wK2"iN۞ J~*2q4c"k3iVR&#ClfCiIP*]\?۞B_PӺbGmLHГa*6% (^zWudC K 4Erˆ%f%,CWћ |$Mi]b3r Zhyv[R7(SWڊю1c[Am?hij ZJ濓ঘ?lޜғ,j~K21 W]K%tKaF>)X<=B%)Ψj%2vo} Z; u.lΗ|I;:= sz3C?G2n)|q1ˑ+:5^d&oO7BB9w_Ϋ34,ų?,Zk#BKFʲ|""?{ΟMUY y.Z׳y w_UjMR2]1*4 yn+غS=cSI.a+tM(`-;t~v6c<|@7רu'+wVµ^ Tｑ{4oJxronŗy}ĈYʁ(bQ&qχ|>bi^/G{ze`TCH*/Q*Y|u] {i.ܖZ]IGg.cx'HU1DܑnoΫKl9<g\e[Ql!c(7m/=42]UKt/%>7}qÌtcɃi_Y%ʧJiB.ʨ-)2HfnYגfAaF6&PZjQf2b eWY{ 4(k.5k[p,֛CRPrI Wz{ iw{چb@![֎z!圽*/{y=Uy*c lsr@03sY(z>h,or64TPtDCny+mwƽ%C/IGAZLXp?|sLeM+s)L#4f}땊.PͪϖՌx^ޗƀ}uk5IS}*眧v24_:Wu8[W6st*+^2m [zd̮Fܗ!i-1~;i<q f.2=yx ^c6s7㧿./%gHѿ nMjz\34 0pL^>]͵Y)k'3Wׇy{_E>L- lֺGC}zQ U1c&rIO=/nҸY{B]{)RqyiW N/kK׸:u`n{_r07ݔOyΛżnQZu=f窱Xg)5v۾Y^~fѕԨs=<YjHG=[qԷ"<.}29|j7*һ"x%eMO<a 3Vrf6~} xwQϳM[Uh^2 1sSRӏ/_&Kji[j}e~tzx3$Z]OTw=*.-=S1%TSvMT-^auy,m:_ Ytp_ɎӔ(a]QֹTLf$ ue͕B,(P`@ZdTE[.i{_WC+5O$BP` ًcj wyˇ1rvac{ MΎaBE_{=yOa\9h]=15j6va'e HnUa|Y9=럂߯C7ib'Z 8l8f^$+$$Nhyq%I_C|(2^a'-@ATBO\oTGT*͑?ﶗ7Ek[Ft]Guϟ1-U;}r+{NjF7ø⫍ta H>iz$CO"bX>Rm:L~JFا o]ؑ#.*)}}] (  (A>}WÂQL~5tFD T>Y&y+pR:Ox̓,jr8"%xd_ V`'yr3ԿB3$$\`Z̡'t8~nGOC(‡OOm6l7VwVEݪW3ԣl3Rro'tZ ]'େQwbBʖuw6ԙ$bjȚkX (2ڙ02. `~٤@C,hJ_CX=QXϟItXTg鸭.1ãW pޝ+I2, y!X]ּX M\ojoUAr#F]p%G|CBfp 9S("r{DvF"&YE_aS!=Afjb}J[zh؄z٤2ui槣aQlYt́5ܨw^!Ec" S'b[ RhjX z(OR!`V,j59ZqVR<_H;+~&gR#}=ExopdAz(Dlgu*VcBPdTLgҊ>gF G\|uʖ 4RL*Om>Gmq¿gq8U=X=Nm4nPZvWA{x֚n8I!2Q8.;GY|O{4QX?k#%?`}'߾ְNj~&o\H%$=ys *#vYE1X@cj$Jl6=TC@}4bԊ&dPqN"YTƁ/?k^!p$9޴6pG%yX~6ˤ-K)o4Q3m6y  ?˰{p8[e ޝE|go9ܼά{\⟽?ߤ]=2[-2G{uۭC :4Hql-w[wp`Bwά ad'-Xzʯ--P GNN@cE4d Gx B`\.RKnAX.4RS DTבU .7BB9`cb ͤLj YE4k&K5dLݓhlmiJRZc|vptL£L`C` @~4~S\d|}ES: ()'+jrP.^vP;R B3W/v j((`6lR49h sC0gMM:PҎ:]!ʊBhit\Ő VNHC=-i4M4ZM(h B:oh)hS@<$11@ƒI5dd8K7^6hJ bE b!M,jHIDґYI$E8!AE""LB"e"λ@w}hD8?oG2펳V羫E:u}̽3~<ϋ~ErCr6f˧.`>>6ߛ\#k@sљmqٽsu3*:OHϤ>m"R ,%T oh=K  /A$Jug*!FVPc㯁1 `0A j&3G6/Ҙ skuyǰl~Ո7}9)5|{r"{( (5w3ڹ݆ni,y vAՖa@@|;!`,֠"D4 5iV!H-%jkS[hц9hw7ZSbbVEBS L"7n-48 ˥ذ Œ!(v '.҈{$c~=Nx~ };07(ӫ`Õ@vԀSFm d @)磙sh=kVz0ؤ3D49db;Z٬֤lMM[Z]:M ebZfɋ də[ kiC4 Ւd9Ub@jS 0 ) ю)86.Ed3: 0 C^Y*rJ((Yα*d.f@_GTj)* A(Kk^3'_dOg( &kP4~ t0L 0C (‘(+ܴHht3 I0h.]dI#!45 fM aA&L5hIu"Lf`QX4 OBHeџ9uqjGvwA]@)H):T`1kb\! 4!!21r2ʑ)2#<#LCX⸘%"g$2D1LP\nYR]P!NR-8&$LqLL00‘ &BRjax 7гZ30CJX"Dpsmoq_"Y~ )g4Gѽyu࿛U~3;gϭ=riTt5AE!ewB@ +dd4IC2L'.88V.1`Vl@%a؁ݭwm!dѿh(u/z(iAïF n؆-Af*Vթ+ėmWYܢ[s}f*Z i|kljt/:/Pi>XMόߺKSg-B_a`l>jE<֕9DWTRӢě}+V3> $__XN2)@e(ǯ4M8dJPk%Z1@` XoRS_Fq11+FJaؘb#34iBprĺٱjFaPl,YlhinNZ ,\A Cأ s)y\-\^!wz O c|8͟5qϪnK^`܎!9leXGW;Ym;cY%;9^`祁e}GB }CGp2~3z~,Un7%CLlYe:l/baf/0y>CzWuQN_tk5۟iUH§i^Qo@;'unj 6R jJp܏^ugi,wXB -c&! Ai#_q)HL5"FPK^; Qo̽Kڝ~-{bӂi[aR2}[e[Y1҈Z dDY/௱ ގϹN1KCHgpƕT,}iZw:"jm+"1^ͽuo.fJfbRHV9)4K. ҥ?03{xl?. ۫ڢTq]Qc.l46zK{Jv]WaF=ewoki=9ַ"yIA{0ec[Zc|kr!qjORRѕd(,&Y1ʊ˜ qujQںԹE~gU܈s/Ù3 9LqtS{ IJa-w(Jv߮{8zIm[¡~lX:#TN<;eƠʟm6..ӗnzm_Ǐg%u 6+$iܺ )T;nO`Qr%Ƚ_ٹ9K {&e$2A5VAKi5Itl36e61OIL663.iR@@!NU{dL6G Xiw?!cьfO._}Yke~ r,rre+QTıM9O؆/˳ &t?W lL O7q;F%,?ö #vXe+toL%BIIs2<9 P[#F}JzBv_sze3hM~1&)YC<$WPS sRXop_>'U&'ONi@|#"æMF>O3*G*29ZvU^~hs*B1\}^XPȀ8 KsQŭ\ OEղ`?6(G<[b7,2 ǃY*Eۑ[i(g@7 >`A! [Aj\go>o!nfӐ^ iC#IFWlF!6[aOB:4Njd. ?Ox/xX@sǷ__&7:|S FIE (.%^V׭ Oߘ 5?P0(qwg%UrnU՜AOorDd )j`Q,<&5ͩX,KbT<5:W."M7{7:_9< 7|$ZTRgJT |5~Țtsvq??KI7?ק5ί.=d҂Fc2A2 O|2ebQ WBz]ߗM dl4?CP$͸ERe_^ô"}u߹v2z 7%}eWˏń5=jEdYi4İp8KِW_;N0wWw!.g~J*v惘̓S!UgNW3*2cRA/Z%ئMno^h^&Ri i0S # n+6-?>Zzg'=f|NfWYy\UσYqE~{붼7= ]~.A Q0DC24d~#?m2C̈́1J13knH& +BBB0.f|h08.0t.6HB  2 &>Cg /ܢ$)O3RΰһCm9l -M},Ul)B^5ዖf0_ >>Jw;IiGP _Ve C+Sgeڅ \|>Cfi|+6AMC7HIp0Z,6 cz[|껋+^ko:Ď-C>4 0 uy&F_p,:?j7U%3ulJz,k± UrYAT/=0%BY?i}L>NUY SH(B X ""`]aRK, Ibu~}b#6ϪĬI38lb5Ix^ri>?춏@|Eg[żl Zwt>|}|P`6'\CyaQ~k՚ $RG^>Gnx/vLA%ǫ87pgX)';w/v'm "۸X/w[YſVkz!`4>i|"A mPU 'ժ%8aЊS\:r^mީ4YQж**YJ ~Tl XbgrDɭ?u6ĥ0JN+CfձYSTZTM&1I"TSklvtAl]Cn"x go 󸝷B a*0l}th7S '62֥BT)K%%ymE~_?x҄N/ *YE_̴Qa3!2c!S3mkaZ1TR !d)d%kj ^X><Si%-j{p '큨I q)m˒zi%.wf:@ْ;txMyЩeef dY D&C耡zz¦8[h{]B8ϭ ެL򬳙 Ĝ\H&J &_%JOYV);wݡbl6j6\|Ks+HVE CBSZ޾A@SQ}m;qmU8<3d(z)x$Ɍs ?9l.(ivwָ7o,p UY ֚#}%#tW:L0P3͏zLi1Edy Ax䮍P},~uCY~m+[DH;gާ v^vP~7I=͜J4Tq݉ņw1^~6*I8Ɲ\0=u¬G03~צ0=;xվ/=ۃ#}WW9FtŘ•gL/t :h8˧$*IzO};pWutCd{qD>, ӝg cIg[E7Ud ]̵zYhmW|o:\H8P,d"W;RQ|Q&'ywgvL1C |D,xs-ԹV#]7OeDQ1?z^j +'7ZGӣN\V4$ b-b X)'L ֌.L!?Jc򎁍a$eۗh[%jjX+DqWe{478kxރwLڱcյ0J~kIvfvw<ÿzj 6+:* 5CtDZpsu3b6}s׉,"k~3`:K=Yy2i2MKߡ=Ϙ/VQM[КڶN9dn:! xN'+n9#Okp>I5(q 닷ݏ4'qbq3b`ጢ4 vL[iU["yp|j '%ߧ%bgQ&U?1Ÿre`odkep!ϳwZw3$)>\G×:l6.rt7g]3/$^_og&MXRʲuM2X)slj/z@6̏숛>tɽ;ʲDF92Q'nT|#tjlVq"^f"ѝ`@ookks&UO&6fOl/rA0_ppi]J\v-U8GHm^*]Jkޡ}P@ V-gݍX;T4A5y-h:xLn " ~NmQ(xͳ}a%yxO(B#² &{lA5/-$iG)e t!jiwd_,wŽʼnqcyF^<Юj3)B~ğ#La}?5\moy/H fiv7fbڅ},\RQkprN6,JYDx!O^ڜ$P`u §9I)Y@IޚVU* }Ʌڮ=)컾}WURgKYa@QfU;tJ)2]ͣ]0&hQ~^x@e8<VoBtd73^doK޶o<= jܒ`N6ŅOos 8mˉܧZ/]` |It'&nB3PIw]ҍ1­O8#H{1đKXUT[Hؑ*)-2[c"Foy 5Y E\Lmw(fۣdm=w (8R V2^.abq){h59oƋj~U6t^N>s\K/ Nϫzʤc4 3cJxhW٤M[l QbU4O%;~TY֢rŀ'jG(b&=^ 1ZTrÄn퀔 .)Vn~߂U3l1QnuhDyiGfWh,\Dʞ);?Z['Jҿ3-Mn}ǯM_څYᄬ5Z)/ <{tU'̱keq^nuSmx[f6JpuV/\eqCi,6JwINa0*3]E8vӻb=>H 6+'YO%ɐI䆮љƲZ;^3.ambGLC-[9AD}$t,?Ekq" /RDf>B54rAB3ͺ#i 1⸅&2@?1ߕ`xO7bMNxD=H&x& )W91NF:3b$T̉1^o81h O*bzF\9Sv~S10(:{,2pߏvU%޹/[@+1!y{&_8 nC$nN+HB~tჶf_ގK{y-q98Rxށ%Ensܡhf27@7A!aXPmo] W=K}%􃨾I@9ؗzPqTʪ/Hx?hNi]$ 8>tXԓ [TsW_pYDhƦ]e(H\2i׷/JC)._;ں C=Ltx$Vz?{£*c@+Rju븀hhIG>C|(&5sk=1hp?k*en$)'2(4,c1(2ߓe'mUυ^Cꯘhp1>咄Vdv.r;l+nn<15Gh!z f˲!VsjOf$OY㐷_L>cCeH2ZPhE& W-==s9eM;$ܗU2T5׻OWV+ul2«45zTϥauVGnmjy5RcLm  d{ ܟk6&|PyR,V3,`c%1vq!q ;s>e->[HVlR@&cO{cٶ_ZGd"V)voϟ]fgPK:katx}UFx+ay32 #+RzMQЬeZ$YUH4& &rةkhQCYyK\߂֧sV[9ф3or%(`%?&!_IJ==XٜXiW6_Ǹf0E@)+Ofe'Ó vl٤SO72j {tD0jDcV>K44KxnEƗ`K+nF`;W4a쑴.=,mC = +것]9;=E[p tcicoM0IEmgӠ@+a|<=N*yzITuUUiXsH"Hh,T~{8IOb4&OJ,XU-:v8 2L H*fmY+,@?TmvDblHD'W)uolXwrד5دfZP)(mN{̀nf)jV{u{kk0!|LX-k\Nֱ_XMͬ~6$5n )iL 0 pt3g$Mr#`Or`?j"O}9%BF%Z7 5x y3>3_e5փDLrz/S^s-yJ(1a2Io\*ZT(|čCAq 2Uc|Jwo6Q9U'uۦDv`["Bwg.f i4x/l6Zc% -=ZX6oh'.9 /V;7H^A1Ywh 8sWmiؗ%Mqi$Dm/WV/N_o ;c#"$fiUʲm~Wcl8P[,} *ব@0eB*pKR`+ VM>NG/]#h+cLcYTM5PZ3wh[63Aœ| 7vC Lvz~izPy8m𤳑Oq؂_p jU;a-z/Q2%~JsK{ dID橦'FV|},?NzjA4a(^, K}y>>]CkQ07Tx=fP{V 턮 ?%`6H+&Gz;IBQDʚ11Bx^٭-1ci}k.6z:p!gd8TtLy0I HxN5 ?/g&eض\j+TAVg[#6E䁣†EIl]J_]ˁWNP1rQ rn0" ^q .J|>v{kOV]Q `+NtZ账 k+ Ҳ)xK碇7*"$ճ P yoh LoM*1`2߱d>q|0a1;9hx1:324Ul;2&!~f)ՁK#d*֪TP:E{U:7\g^Gf2?}\{D [)SX*h$<,#۔N»;R$ TGRHնf!F-Ov2<<;%[D<Ӈ<+ um>+VKeUy*(@L& Qm-mrd)D[ZCx6][ 蟯yܾsVJ* 1EPJ X*yL QaEw42qdm| SWAn^_+x7^Л/䦴)|w~I,=P%|/Bm2qߐG"\^Gbon{_Ǔ&t¹ȝVn3::k6U^i?^|&dPqhC8U&*ۖdwFR4:;aQ[ys`r ڌ ^jNSի*%1V^ُýaWn@*Q4lIcК67uĢK`&7 zT\ pݔ.huvb 1<"? F")π5ŹɥEiBQ&+,} 52&] cj roH;{x!:z{H2!M*qg_Qms[#GP;J0S s -1X`LP婼"h˼촵lO.C:[~P`~D&4r> vOT?~|7=NWY$>v~w-(g5Nq(S+DFn'K^J.ema)R¬KgK8 8}\DLu"1u%!4}ä@A|3$P[8^ʸM9xmLf.{OvҚEPP'bzSwR13 KF˶`qJ:2~)V"b5r,9f0L'l@9VA+>q crOA>끮MC[ilY0s\ fS-xW k =Q*yO]uB7vx #îw vwq,$ m=')JH 7t׮l[uD!T¼!YL^j~f= ?_Wm3 LuGl#5qOQIcWR(9pwಷkoug8 i:!X$yX\sr{lk5NDzopJ왻 z^.{ȝքMO+]O+XOxRvl=<4Q#LhTHqM޴⋕Q*8C}t{4~JsyĘ kڅh||9DOcM0$# a/ag x-FGúKvÚw8>9M whspgvD|Trmu#t$5+C[t9qc睔Ż#c?*̘f TQNd6V:ܮZBW\LŰw$JEu` oçZ`_8Cma̍ ҜԤ*< r.XϵRkhPhq'5Jy̒3r !IY:Srqq|GF`aH%8!7qu@Y}oMs-{_rDkmʖ݋U5?e:[sKMI'@ >%,?<;`Pƕ`/&y0|8>t7G+tc ttT멐y &1tK$ըY!`rkM',$AhFJxhbpϙ4'C?P7Z2C {I' &>6m| xkKGdGQgpw a[(缭ѣhK ݋ʥ(*4]̰19 rǓyGGE0[k?TV c5 Oͨ2?V%P<[AF_yNmb$ R톀+oѡ{U/xcLɲ:/*RBwv5pTl kse`ēJKKvY{C>U-t&#^^?^{`?3<3K PK` *%'iDyŵHdyLxVG] c"d{8.fu7J]<@Ehl maj7G*.1^ϞH؝ ! {w%nyyvFhkMFs^(ҒJ!}hhжN'/ѳoa*+_0Vf`s}wBM}0x>#I\xU`]iNoF'MZӉmSiڔ/ĻM8ClN]NZ^ }v~|Nb8zj/슓o96oZ+?Lmn_3 IPoA]ofW<΄X}"g?8qQvSCd3*aKcWr:1c,DBe4j'Q}S {B2чBU-_AU/ߤT.aY\߳Z]Kn*F/FP&_.Q GȕL%JK\P`VДagfŢp4UD¬S^PWȢuY$YG]ig FGxj7MѶ|P -Y@m6Seǀ\:nh]}S|BNߝo$bQ_WRF5HYIM#LvŋfBdn}BcpFQ#>'73,<3 3͐RO]0g7.h/1ozdɕIF^Z,_? BɨD3R |=z]Sr'GwCYQڤOV!襚@_H: ,k2}:wOq[K_t6X=1Do>^xAT۽xUD%*/@8Ok[S?QPq艎<' ҞH C{{nbes.QX͒K^^@?0 rʁ|)œq>OYC;R* <~ sҟ6>ҽy|&ugߪ X~!k{G|1$ԲMH  @Ven[@҇-0K*;Y}ߏ֍Ŵz%abGMxQsֈƻVhð ޤK(Vwʠ;vʷ יhfh6/dd>N66ϙ]N[ݢ 믞f8]|.tQ21KUɹ]iFǁ}EA^?  1bto.څq?ն3RjykkD5qSWnQЕ*cI=t(.s (bV%]LL^2꜑ QMÿi]A4+cAy!> ,g1tIAQ̷oږi^$9Fg(h@\Oj[b`)l΍A5>תUj`K!ҁ6`Mw=6B/Fu/A=JkwWſ,Z9?m}+~ Jq*"̒W8UAi#FPUnB 9`֛9}u1:kؾԤ0L˕pyU1|SǰW^hz4D`~?h~XXu2bȝx=fAYE?ˠJ2'8]V=+A;g>m;w>sG5rvjoZGZK؉ ZqUw ܾ)IEk{| 9fZ0(مz"?s1_]"_FZNCQd]Uq 96ZY&u( 8-]Ap2k:iTSH0Gٔd 7ɽvs9U|OkoRQ-slQR]U^߾g_f]U+a!L$Tn.KC~dS0jmiKr ޗ-MMe.%1sKiJW@ >MjW ~ {]CNZd&p--c}gHZ["uLG]c%s Ϻ<̀d#2AD؏]xaZ,0*/3Ʉ]޾( ='kfI?jCF A]kGPtlo07w ߉(t"׊}Ý/[9,KJ!%[TswX_F)dr*#FVU琗RN)X kKN;B%DP/${P9FàjpgzpG%DY]hiv2|_l >D$HB|$xV ]~ [kz.3^es:2bNlHY1Mx~uGue A `}8q* ֮O=|WxjvμЋ._S..uԂ~{+R3 (;8b]A\> z"a&Sxq{g2%K= hqk 4yUvrԾ+\-Sy=(%Q֠@Wlv QԳP+K. LP ':]5s}Z{ my(?̭*M9ԅ%=r..Lg/;,[ҍm۪SzPsiڅSfeAޅ# : Qҽ>yDc|mx]s2Y0+cln_flw b-2b<p@_Z/߼,B( b,H[Y8[ke 4{?(ۅ)q5js'ײ((]#%O0t1<X;’ K L(~t@V((VO~85rהH$L~m6GyK"z};IuCs? _p|LiM1\.M }! ?'rH@a  #];̱ZUa!fܖO( ۞}z\GA 4ӿ݇գ5`P( _D$SHi<ӵt<\M)u1姈؅;G{SrƑKт"'$\N[粍i:j&%/ʜ lGy_}_:"ޓ2i21p6WCF>F`":c 6@j:w>Vpt5,)dM~g"2@;<(_휖8 A9IcSWP*bT+CCE9TKqmhXkPrBQcb~|L}e# W#`M:C)@H](iA݆A:k[@O)bXn 7ޭdET[IN`e)IʰernGXi.enqA4 za)N>=K7znFmmw .3Q5IuԖФϷײ8i; Bikqj3jd^֫7ܹ$DC+*LK s:BeugI}I#G*s ՚]1|=~]! 9*%D4Z\ ?'RIƬ+owZ:+G]3%e 뺄aĝt1h59c$TP]}fݏMz`4<ڙ?h7VS 秚 yn6Rֹh6/*BsrI, {\GTXVչq~GRn񱳐։Z2x|cj?,S"/{ -4i-R,='%9\㳜EDFT+G~n;dkpt?g-2Z_4_]e]x \ E~嶐n4EkU١ek<:#: )lQ1dw)gnc@&ۋP+PH,+`x kDٟidUcYf`;mXtFTE A̩D[_6XA1bX}9 ~.̜W8KQ|vIz^B+o_[IIc*:W)n=S 5776?#9Vͪy zW8oL ώDڞZMz,iӛxVHnx<K0J hYlDiѿOI:LՀ8sZ4IaN#'=cbd2jsyߺʨxHbOE 4Z%M્- C앵*x;uP$p7D7ڭH¢ZLR!-+X!ԡ8Zem_)SL O7/ZcP P~xKhf/yeMu0)Xd.QԷȗtzIT߬"0 Qż$ސ39/`D1gsѱĘ㑉M(PSSizǟf1mĬI|н*)J؜q^gvۚI_T0'ڄSh7-XEg{ת|S _+$-d Aqmɘ;|~w"=0C)"WwC2R#.The8q{1ڍWIpSYZS'cV-'B5j?ENZ7qƫ*ѝa໱NHϳJkLmjejҋ0}֣Hd-ԫhԯG\lg;hoޒly]/8^iQ..8yF2MF8UDVw*Z*)[62Ӱcn/Z#jT1$aYm(u#է<ڶ/%c..&loF!m:Ѩp)kin9>Y|(P(kL0o4$rVkiw0,pftrH 5\ܬ<.ִyV^0 z(tXe Ł&jqVV"ՖX-B)Q[{" l ~3z˓-i*{2N[N+ K'-ǿ3ӂwǔ})u$@M#/[HQao65? (( D5jF) ^Y/]|7ufBv΀/vb k6W!+g!91΋&zd!y'u((v䵍/̿ EZ_ xhF~)+`P1^R b]*(LRE.mNn}JZ| ?O2OւIP$N|lKD=+t刽󚀷':<,ɡ[Q1ue/!cŏQLWMf QpGY R9!' gk3k s4SHW l@ *O%c.ZC:9 z!v g|(%2/|?յ.`)TRꤛFQA)g<׸VC~p~d[jͬQ_yd)GHwt;y;ҥ`8Z3+)Ά`}ΔY{7?AJHpL?6ըt0M%*o&xQ H03ߜЇGJ/R3q#*&P{;=8BBn F1{x>#MUp`V*C_,G./ ^Cl 4M`+Xx-(yl)N4C>>[~D8"o"1wDNx~<`>m7Y2b+7 V@N2FH za3u0B=Y㮓8& 2Q!e5@BU%'0J}rpe֟G7WUrݞ y9*LΓ%N(tO3UXyW: ^[a> @ǰaR R5xц́#?{ZdB Mz%Qodx@z8l`3oſzbWVa0_a޻cj(%qFlݤ@mP?)\$e~VKO/~'lZ͎x 91ǣ]Y/{kyc/cq"+@*% #`Wʵu򎹗7"1gn&$"jpPѫ+˱_uEKFE@";yT~>?:>lGbG {Fᗳc oRP Q$FXGX8Cvj>%q\&F2zj<|]@6JڂDo]q~esDϾ(\#M$|8W5ŵd 9 ;;T[VEèi(^T  ۚr%.-4cklXXQ:& iݎ \> D^62I˧N$]"YEDsаCopYWT (D}dUbٽ@D/_ߑPYVԄ>㫉p{kq>Lw-Pi&A6AzbA;hSDD#i㽵\έYENOJ9ȯ A-Њ))V|k &)S#QCߙ,&Ҥd?sԓ΢3:X'َ#&u$^i:%84Z3U0eW^C0?d Pj55x'v鶼P~ Fmj4SՏ^dϋpvcN+Do"RYcf.tn9LfW2 Loq?TGۙLqaV)/7Z:yD]* ìT=yAyXQ2-+/"Ftr\x(Ӂ~S!jήتPo mʠg{oK.HWIe{yp3oXq&6TxTipAZDm?R<B-#!5S~8/J {}P(ta8qd )@/2-pNJM{XJ,RTRvGvzLY*m6Ɉ8/ٯ)q͓+"s0Е-RdR]o<9MB]j#"TX̭6x. -j ޑLX $75\JR!&~ӭ o'=%#Y'V Vxn5r9)*P$=! FہvQ>_Fszlq.[E H=| rbOֆ߻p!pCY8 ŏ l=νH޾pd-\W3pd)]r9MdŒ2q{\]6zx(%Eq=]#G7}-^L_?+Vy\i&1O4@-Մ{ՙ2KOgy5's+~NoX ^.4v$Q: q)78A,]otE*q<^I7$tv?IvEf@7H~Ȃkby&@xPf 3MajnY@ 7㽐xrs\uDgx 'kAR_CaW:c4)!z0y~;O8qᰚ7hH\L:ʪ]nʷݶhТ(!V?&s4ҧ4 P ӴG7 @zqY[\eBI) b| !Yͣ&_Xj4_h>ێ&Ə_4}(Oqy,GuLoVl^R+sݰ-M.NNj瞆#s}@{/. % 4xR041ǗW?Doo>_z&`J y.đf_ezvsm:la#H%g;@6Xs'$ U @$K&GM+y,ߦt r!XDWkg7)?53zѷW|8+8H2[e, MYRjS+b֥Ij65p_̰@_C_i[2 .~K5z~l,{1p];< 4ב.<`: lw}D!H1o3n!5?T Kn>'M2qe1,m3k_-z=Ё/ P F|55{i% |Y6l.v=Mq8d5a@f@CFlAeB|3T}ߡ+FW06RJ1wob;M7(ߤ^] IO]z_rH0M oj*b=*rmjA {=O:q|4%/ی'~XA@}R|ՏFqgp0x0Ar3u݃Q}? Z(4[(dَɴlˌ皬O9[T :LD Q~AFUROQy=XS>]&FjP=Fm j_HMs|R߇N[l۟+'ۅ/zPރhءgB):>U4Ѵo$JҎƤ? ȁ8mufK-xXnUBl)ಙ1fek.!FS6%_~p]WQXH ZꙣmPߠR(wrs\OBb 1uac1 z &3&Wzi2 2 k/ibq⵭h+ȠJEgʘdY9QWd&Kvb5΂fnI wqluhr#@7h"]''JPjni(o# XW\Hῶeۮ~ Vadd6G덼ѧ́kqoĶQЉB(y7 R#^mQ=84[AOC Km76WpѨ<쁵k'NtB3ţ&=]eٰL}aL.]ĤE$zINq]y{i~ 1 ^ǸK wRE$}ֵZ!e xW%*N%8]&+%z µ܀& ~j,"øH/F8l+PNn-\BXP*VZW+eh..7!ˁx oL33HOOU}3۹Y5=hÍzPyIOp`4s7?j<"REizPa\{c<ך}cwl>C)U[ ;__{ _d(Ϻl4B/Zʷj^Wxzsrnc[ޑ它xjp[&xWRcR B(=xez';7[&7إ*KV;zq/Q7❖$_ _sRgA9n@$i^L8iN;L**fWmv"әeR*g\CUU5o wDžǓ]/RlA-%rÜCE)EC8~6MCڝ^ ށ !bIF@"ԘDh:Ŧ+A-zXgԑ?YQOj9PRgu:ڂDEQKaacIXdG^NaEHYY.-Mol"!dGUq:忎 q#G+Y*~Wɝz-OF%Wm7&7AG;mVAhg4CNW6U()Jo\=Q~x b,mQˆR zkz@ŁͷCj4,OwKd`hǖeQѷZ9slTO_N?5wؔ !Kz2D/DCù%pDh"^^~ۗFihUbƗ,%V)¼Tޣ%V3%1Dh07 =ˆ-K}4{xZwDY܆cc&Cvm7h+5E3d5)kEd%: l痵n@ѣDnt%;/8D5m .22AJ1\~AP뻂h^S54-J2t=PF X ˵) [?_iܟpO+M*-hy!^$ > hu e\PO= 7%?:xC(GIfrVȞxcG,ȱȅ9ϬcaoHtMZilv> BX s2܋2TߣN UV,gXgl1[qF0B7-,}KYQ_z/(PhAUھ`\%LKs9J^he.' N.:3H/r6))TPyƬ Uܕز}]nPjKqԘtS`"$)z)񝁯aM;ؒRN`ppý+p=c00yb}f_I$ؐ-*3HXɽ;7)GX:Kfab/4 ,'>_->یu͆ vgJF+a/LiA{>Nx`SRԁ\ċ7{a7ṙ_# JdtأJ>q2t5;6ЌR?5X֭,D#~gdX5WŸKR,)%*hemR;Y,$nGI(.߉mH>p=(co0`+E._0;U0!@5l2D:h<sMLb%ߟYō@"w{*Y{pnT/c, yU6>ƖA5h sF@;9rwL2z:#)`D3H"B aWhѦTq}%\ܤӁP4Vub2k0Zu;+9v]=;ka~[mnғ+xGJPuIF4$na*cM-/VfNf$8V[& ]u^+';# fW2tpi{S*#+}#zZ.^| fVk\@ 8%X/$cbxHbiio'Lvֵ^V/{1 =7zՌdD*HW$tԡ'[hqq)-w"KrИRP$v(Y%Bg+Jt_,|73fְ֯t潅VpEi_\+yn  qY0+!YW} 4{> 9Hl,;Ne8tMC+R|Bސ1G˱w/UE)H5ҬIO>ϘX>޿,6$GjlϫLIA\ZህbjK=ZF̈,c 溫21{2ݸ"#M69gAYhTXGRۄ4n'@(2VYgMt" ǙqE=8~-WBvU۷`s["39fO羙^%=m_@ǔ,?%fp,V[O_6> !'*1ufNa!r5Gʅ+[)Fagh%`ra߰1/xpuNۛ@E_اX]]?9n lH 1"p^o@9 O(7^=! BY0of1kPFBn(h,,mer5c˯uس,ȸHmy Dt%L37 Cr a~o>mO4lRud2[-<|pF%B:xGe,wdz0 : S!JVJP9qwTqP~G{"l߉rKn3NˇQ1l` (kNQLsWhW0OCoUbӤ8z /)HT=*h`VE#n} PH=R2\mi <Y`?-taVu:j^gtD&\L GSwUZUhu %h:,ab-HkX9?&]3YjBQ_ >y'7CSV̘^ w4Ֆw#{}BF}1+d"j0]9io}Ժw#6:/%)zD̓0= qnArKfy͎;m/1].S..?HX*/O*uwsDCY'\׃#0]! +ذ|£:g^›WF%ujm-iCa=5-;PAo*VV[M2 FP J0#ֳw(۹-z/s~רUk!.w gYN6bjWIj>zPZ}&e!'%5F_JIBt1C }^$iUOׁ<)r18:<֋ڽ;镻ٕ =){sTt.B}On vTCh]t/W^ƾ n';ysEuS2_D@^Ʃ߃)GYۮY(~ K:LZ-}JzYUd* [ .Ylq]R:4 C+l CQ6a}~j#$pc S}5;e!D/  Md 0ri(FY`  y x^8zq+$ EnGP+f8O^z2UIm kavd$-v1"d\C.<Zjh9GF;::D8msWc qL`HT5pX]jҦ6ֈJ@BM'.J@Pm!"*ulzX oIΐM!{3 J._>ؔ&D`-f{@T*GlClk@>܆~Q*9K1?tt]fcDͯ @Cg { ,7'eќc\r bュ5{iG,8P9N癤:LHxj sLq |Bbcx u9cEFa?vn,)$J$U֑#U#zqL1%8cxumCٷfAfk&H&gu/Ti>J\+{-h6Ę!J+؝U>ucmC:j;Գ.q[ꡛAzqbJx?ƊFV k’0zEyK\C`D[8't_0E4L */+Sl$Bd(<Kr-TRvK9;|铴WLA:*yooO@c]ij$:nN-hݭxaM_"[`V R~^"V*(DW`BvKz,# k,>Hq85O }.AiVO~_P9H bҭL< gE@k+u y$QO)ROks42"oj;[SՓta|X;%g4TmGʊjEn.gXtvZJ#o^ 54]Iv:WcIP)]5=3)ak@S\iT%Ȁqz_]ܭ#d5?(X:l <}n"&AK20,\/euab3i3YzU c> #q@WמgIx%DJU m D GܭI^c1L̄bNϛ2a~ w|}ç/oq$-٘7WL#B<cPͪ5ӼʎA;m EۋC̔ ,fACD-SZ/YH` b{`ְkJWjCd=rn7X$&}HD命!i܉LN05?UL/<^l"F! p˵;Dz(4u^-ٰm1Ni Eͺv?nx ZHͺhpiP-8H)74-P"_S=nf#((v cֱ$/e@6 B3<#f]YmUM<"V1i-zT+Ҧ_;[&|o5oP hmQ_ϙ)4OE y46L +_ )Xkqt}MXtzsI.k-9$s?sDaV_6|eQ&qA[:*C0ވO$t6`-1TP Ia"0˿預}_hZohf`tw+~$fZhi#OGgz\Rc+z#w˰^a*ϣrn>tqb@oBҤxTw-[I}΄*[ %%=]h'RorS\`p |%:61\!Mg4{-usCh%!dp%@}f5:sܗP}߸"RX:0tOPۄo* c 3L@b,f!u!sv/`jJ\ _v/ Qoeh󴟩`ickl45EG}")Ai֊:^Ba.=R-;PM@89م_o&;!; u#"% 8S51eڎo&8K3/i4Vz9~VUƌ*IvR3L+~(š@H?T* < d}zϺqu4OyvSEo"A;f[( Y05r{9pXWM0(>E$J\Grm̘mI!Wtv5z ,QMr5%;ϕEw6e{#@2?Sm62u>pt~@V VOx-8_}?i7~N3 ۠P un1-q1AR c#SLZl@SJzg9easZ?Y¤y645x saϰ<е8 -ĶE s^"kF(nԝr`wB+0U,8ߝ۰zp0DHr p`¢*11[ݭ]|Vu퀘5Hg-r|P_FSqTW]Gίίkx,tTsq`4 ? ٴ|_CrD=TtiɎ}n^}+طnnj 9X87,'ۻ sXml|Ϛ{yθ -l(6q, C:)$bm W R)שm9#K/M<ɵDjUXoc6nńTHsS{CXfl>)wƊwA ǧ{tͧEJdFIq[EJ%B+hr} p? j̐V˿DA%B< O"nBQ8nLo 9~cƘ"_ D Z< ' `E1;5 X;L[m)zdSEEElq0"gĥ NݜE9K=cA]#VjeF$#+ hs> ALe4ZK$ T byQkXVaFkv{mWg!~E5ꥰCe''?a7FC t^+=Tw5!CV㒗fC܉ʒd8p^)D-٭݌nc.;ÇKP-Gz>aENX Z#^av@;Bda+P:I|1|Φ"Q= uT(9q!22bAL`oi;ƜbL*EGݜiLKrXA҉*('hĴBF<'%cX %'[Ntp1c଄RBA][% ȳdq!Wǒ0dd#1 DRbߑ C.G#Rhwm_B>iKyhQbyv3=`T:"-B 3"Yƍ@p#%k2CjxTVTOeB;OxI$-ƽ&7^0MZw䈶ޫ\FA,Mݼ#ꏂ7TOeڃtaxVa'χc\\~+Ug"=EGq)/hh8B$@Yyyވ1 U-ȏ{8/Ez2zԔo#ͼ46b霕- ГlHp:ԧ&X/uӍIZ_z< zBA/qX<0_ףvBbd׌ !՟V-d*1x@x6y 鱄ۜp?u 01ko:ҹۙ[Ҁ|3YdiCvaɭ|hTqhH'UAjŒTBe< 5U jT6E\XDs5~t|FFhťCjõNg +; |Zga]GioLa&*faj`X*= !jdTi`.«hmaFn[B_^T S0NΆ(v~ Ch6m߹2Y,M53gJ9Tp'Dv~Jrt@Icvi] 5%*1'#Tv h]8eX:\"[~\:9aν&WyՄ(E@4ʌ{e'ȷș-[;MX?%_h+7U s $zpAWRK'&] 9P/9dTg条4/2ۀLUn*01/B%g*%9 t fj9%_Tue71#s*2]1vK;k U?r xnQ%ǫ&{R!qbP@t #&\Q j _+h 9 F"C=Szָbe_GoW-*7rd劔{RLoV :!Tcn)-;`kT2fwیBAŸ-/)bIxɯqyY%ja\ς6u <!) ^(`>F HsNƁI }ĬP.gWф6/y#|1yX]q4H]7>`۪ShCOM{JIUa*Od4]4CM㝃pNP/KpżÅm9wM[?Q#6(U:܈lUN& ܕ16ϕME1 M=jrY' S81H].loy7M&P`8,=!DUR#{bYT<Ώq2 x)K% D fnnX3 cD05_ᰯzC,}7lU#,H\RRHJdQb~ $*妐|µj !3(SEIbD -@5vH#?jơbÏ 4;2,DRte B%Z1hq!+f*)ӥӉ&!~cӖ5j WRWaTA- Sg|coPTr(̿ne_a7!1i/Q{l#R5Jv#z {L^r @jl!Ǥ,IٳIZWSNgn⟙#eo> GE `u47) 'Ծds|E \rRR Ι U&^92lC "\11bp+Eh]qovR3|CpɃ|.A[~#ei((BT8AyM|j@9Al)k_V@AH(Sh K*ֺ9qP}Wn#q?sp8#v銣yFg@' 8ƣ2BNeC~#-hF"ˉ*}k>1E`a9}%~cf 䥰?%W*.ϴP vh ~#m`a0Ч{&M͊PE@D)K; 9}'WMd̿/9T+3.B> d;9̭ mZ(]qP/aLA79;KmH`iA"'3RS3*Q(O9Ȕϔu^rx沧5%tdOrD0} !ʻ>˫? LYn#Qލ3qq3F>;IL8pKft䮦`*fb嗃¿٨Dmњ1﮵7E՝)mAOQgԵZq0,@ݭ_o6U6 *,Kc/İT'-˞|dam3Iޔ*ءZgN).+$|5[mvk퀝_!KR< <4ɯVuRN_ՌA՗BKx(o 'Q8= l ѬT r ¥gRk)z "?2C!o3M'H؛6Ig @c 0iBhD]йZzS] { č0Tbpl+'D5IP+eN$8wip*Ջ~-w݅ XhAeL沗Q?I wO%d|.`B4M ݴI`sKmٷ8Ăw?Z?M+ w'?DObrQSzPlds 0r?$#@6vr>*D[/b\33 H;e#P~9f۪6~YXfHѪq#)k k׶fTH wXuEY:|U7~w@ ^ |K,"}gY yqm4 IX\q0ϫ~w}1C^Jji#U%,ۧ k|7\z!v{ު䐙 f۔؏~/7 ÊX_^Fmȟ3NDyugŭSK|XRQB8:Af?f!ٞl)M 2_$OlF꒟H/z-ڏ?8=4S5݇h~$Gc1rFڜ+y 5,ƇAWgWV,$mVf/ӨVuZXJ*:$O0+nc{!|^K'XN˻'/=Yw3 ( 8{\_<-aU㌈3,1$MZ@AQDFE=Pf),3Ya/* @D2~·T켙J>8TKd( 6@ގƢz&+Z/ K5,ASa 밎-z='Lg}$Q{N:(Pk0|<)T+S'5V6uMmz+uc벉`f5 .2t/Ț*IC*ȉ5qּT@D&J)M> {溈 t`o`z̲PcVT&]NDMʊF$*"RdI< &sk-/8\R 72ߐ|#ŵ*X?)ZcW(0# Mtoc@,i)~, :eKzG]oii4>H_DSuiGջzpovF` av$Jʺ LUGgKSnhWA.Is@U8 ^ikiH hϤRfjw$((q!>V^Zc#tiܥ1݊&R2gÝښGnRbSq3NofMݼEm_Qbt_\ #[_ff`h $ER)W3^ M3 iHzHw*38:ԩhuD֟縍F#H"O^4@2G7OK tl1xzFwt~ e!KA_^6 ZRE'cSZ1%12|)L 0EzgIś3QH.ٷF='o',ZB%[$ϰ K[3_ G{HY~Ssb,F Z;[պ0K1jkale6{VЎq~ԁ_0?c~P{KwlGghHu -7uIAJI8''kc&EQ( {"ۼRR9IL ^@>f3s9Au!dۗqǏ"_rDJWS$㸠E׉}k^9Q쨜j.8qҽ9f3B!?AakI&OjI 6%6EQu^5<ïFRڬ2Cx5'!LS_F.Kg+`LNw_9 jON钔xoT-Vb+#sTW&5>.a yMW3,9e "ƀOG"O"Ȯ dj}nܙl}N ,45N{􃌨!(,TTnN;2յ #%m/eu]LXBUKQ)ځ, QJUXݔi#:=f1Z>p]}a*׿='1Ru@z=)ҡRL1|&ɁdAl}Ne1x;4a_jKrAȶ&'AR[ D|Du5HN0@ OI녰P,%?5 g~^(Y+1=$clm(3;mS2%T)y?EkS╂3-wһ ~j+(gGcr,?@ w>$5|l*:\y݄Nqa%t]*`&*<Ru ` ^jSgϒA<*wxHX;1Gٔ LzqB~1sVEV#FmBBe;;E6v\yM9 4V+A{-_[!AՊe6/IRKKՓds]nA[oa}I3i!t\!ec3w & \i 0"6}[@`z~1L@s$z`G2ZQ:.ju-&`i N0\t&4!( d3%vJ$B*Qt 31.L62z nliw yT >Ӭe;;*kW% 0Ձ%1NC& USʟb=W#SI``DZids Tts!9E5 Lu;bR^2wM#~^lD 9Zc~^9%3}I~KiW|^у$&T&,cZB ƌd'ӌG7$Z1Ob pW)ԂEk+,e,OT>tzSws[vl~ȫrͅdVeߎJJOV7dXRUTTCSEŗǡL} ¢\=IѩGi|4&V^MBWɀΆ{f'ƁX!;'b44=2z;ehfg C S3fHTn=ǡk}w4%S4h 6w>ɯ3]@%@!I~}3r\ɶ4H)uu3K {rGD1e1_d"tay=zK-=0#/3DD tdm0$~Ԛ]2ZfẆ/ėj䘳.I'> :eE<^JEAڹ3oR"n`*|NR_أBtNlggk.82.wT1b?APN#ғ*HL-Yεs(ER0LӴ:Йyx}m2!dTm0-Hs1f$ax2ƣB݅٫p>w+0˰f>Ug7'r5p{'uڰ^uifU%8 kGz1nn"?&mP4+s8=ZI ˓9E}A^P13-mxaA; rHaShJf8nFpL5+zB`BE` º JkxL f=J(ĝܑ9wx0(^YpŴ؎;X%.*" x&-S`4g/SR,LR{IbD#D9-3#[dBO" 0ݔHh ]F^bÉxDBH~)ߡ,_c'>C&yIGl Edڐ|%N`Zó?,928{}I/uw*\Y+S0"n0fXV\v^ˈV\ 4G /6Jӎ8u@s ? _~h[hߜL7 7Fi4A^Q\/#@pMMST4 )sd'#[͚ؗĠ +_Mq5sČpHn_L7"̏ U/ˢof`|r$.O܃p$4WqU"2L..B&Cݫ $Ǧ҇+-W #M'8X YѦ#FiĨ;!~ȏuEg4F8Х.L Jk2%+8800>Hw^fۖSS/ X-?L>٦RE AhXX&Am, }*5H-$(.? >tHe](gQOPT(9r$A> @+ pq܄yp +|71]fYe\g34P̌InYB\u>y )25n#gtpQ(i \ jDP10M ΪB8wpl@x0wƼu GzityWO6Aר!76e+-t1[ D" 3usRS0>'"P'j s|3ȑ/7MO:NF̆Zs4icɟrA1x,x`"%I'<{5u3!G * */jɛ84xE_XۖQi鏅#רg٪:l8wy<{2OnP$P iwQT(u * @\̜:^k*v)Z haNsgAXLe5( ~,?S6w:ZRɣ8fS$eepeV}UP |''ty-fIhłD<LJ6+|謉C@b7G9.CsW*bY"&5Y5cfTiZ?Ch]\+f!)4(v&!0ke؁"X&&bkM:0<U˳,MP/g1ue JŐ7CP' 0WTO n"` `??7x<b9 ӕݒi] lg '59>Bh 1Lѥ2tǐZCcE0,0:W Wn/HrORr vʣ G(01G_/*}QݴYMhMy #k%2@Wx K3QNxmdCa\Sp?[W*_SvmK BJ]nD'DabęIekip̱>86FLy|iZ1 A."9\x2`a؁0Q%-O<49g(@,~,DO#:O/܏]aBӧ\( P1їjOBnr?/ 7:SJx'M!}'[}XZJ荁v|O?*Q ?5y+/IB,AU,(}.`)[xY49'E3RFpڵ)J%L uꅰYG/S̟ uO",FF-z"$48H1!B+hS(DUUg)J ^ǷFj8_|!\0քqce 78ˡ ?74sSCưQ pdd83*Fl@UtXo& &&diT,>|1f}KbWg>nz՟yWSs:)@u7GiXy OH'@` p)d}.f#|HfHv)S!jDGp*UnGK1l>: DqXJS>֑M&Wx"8L &#}",~|~5oΛ,oH5W"5  fg 4hh][ꋓI HsMЊ_-q%$)f(rB_De)z.nS!B8e%q&wؖ MMj~iIOS]\P}l@m\" lJcr rX袭fu02ޛN z{ʭ3\v,W__ers/S.F;MA콽&zt|Ȍ M.F+u*d(Ǚ@xzHXľűR>z#A0% qZ}P5v@TF/\Hi)i4Dd{2}6B9sA|$s(ksIV`Ƅ3MviJ\LV Oщ Z@Ĕvs*D;bR!=b}ozR>9_OGظ4EQ!șX.풨wxϱĚeep#I{'FLġ!H%Ba|噛yiըWPO-1+T5)fRy5!,N= $328$֟ݨx ,A#X9Ӟ2߀Ed~@Qb#(q %:7?`ztu}"?f[|vAK1XsCoݐʚ(^xy),ށao$*hqpV:TO`ɯ, ̐ڂt2qxx 0U$g9v9 i]#2ڦa bJ&\Ke#m6@1ͧprWp(v9*6 i-j>cYI/&Ԙ/~RNU?0o8]Xk!^HooECH`Ƀ3@Q3 .p5OGF>8PJs-)#PT!^K7I"uk5uC:o7 'U;hbBͧiQ]z_c <)qnypФH4b_%εk/ΙF1#yu"eX.mWo| Sa~dEYQW4 rztu<%ra*>[Rǣ<SK~P ӿ<韱jBr;(+fqXe[ 4aU8+uE˒N82'avlhS"Hݎu#9Vb&Mz} &SEzD *(޾n) 疈yZP%to9vm:%%`H=@J{l!v%^&79Zffn`!Lx;L|;B]<̴8k_ї[Tٷљq)yp90_&vpU:a"<dЬ$FHLD!nؒ*bt*{At~~(:ڿ$HPpEy\9Nlq㿬t$ڰ "rYƭƝ ' ,0\)/I~lܦݟ}ELc^E@ԋ(_dQ!k9${V5ü.]N vd]Ze^F>c-.AQC>p <ե3/dMÓ"hBJjH ?2 rPޓHa1Kj~^M\ҙ.SBh.JPB_{b{m>,}l6Lk&S!DX ɠSKF5XdSjwѣTD6#:*4]puuhGvXk~8aRKJC\EB[aGÏ1,B-65b\4j5*Aan+@J 2`>^ܯ k"-4 VrYt"E[-9ظ^@jKʈ^8R6(@Ymw"U Tu fuYUŕjtZ?\Z4:*X;+\ҥa?C3j_LMT|$FKUyEx?m7sLxFvj&|~+-H3E7e_'ByEd%b+.!{pF ¹z[EѰ%WG-/SoO,m;rE"daf"Jk}{ZI"^/{~#?6I 8Α b?,haiP[_*?ЃI2ǯJ!:Ht^6Cғ;/|6pK?AV#EZu ^#BQ9o:YkrI&OW< &nCE@ bT_:"j`KA] `-Y$!JhHAKdgd)"`V< {zzzʼvud{5~)XEd¼5Q@a3G1Vk1Ƴe^;9ů$1[RFΨlBw%tkoSSX?{ TEwr? ZgmT ~_ mԏ,a'T Veo9Jq6Ff@v58T.>meWVQNǫ(Vc) xT=揧&N6eff!2Srw 2mFYa?t_N8#3 R\#wA'Q~6)b\äS?_/r&w! 8Hw H3ۀ`(N('R"^b\dXمĨ1 %hEr"1ǰU.'RGiK8L]VBwR*S7pcʶ!nj zp_`@ZҨŶQ]K!Pt *_ֆnۢ6M4w26ϼlث)ȷ!#ʼq(>xQ|W@",@[Pa6zՎlnRn}ֲKכY?)S8Qf,< x\oj$LsߍaYyr_izlTnfjQ,i%[X^,:IWX]7H5/DympȜ7 Oqi (:RP bpiGXߨxSÜ ջi4`=-4(u+{E3JJGa|-U,r%yˉNp1RN*ȅ|Txs7џmg|FE'\󣈋tcH$r+odg3]Pcn2\)'aqQY)]>Px@k$x6iAz)//eNua@*$y;L r h 7XA8Eg6Zyg/ZYͷ^z-D]2w\d'& i:ԴyH;Ƹ);0/PooӲq\,(&.v4S')eBACyTo [vH%Nͬ׎2*IPG֢tr./-["1@gq*L6@G+kc^_!7.Wx.g @~q& DaST.Y|scVuKP1@W L9=9 j]6z-`7 _Q&nѱъȱ k{=E qEG.\z *%AIU3lpmDWT[vy(0g,bfQ'0{K#R nXQ[!m]#xGP<0ȝ)]~+Wn$SCY"- &B9 4&m|UuKCc)`9.fy߅YˠAZ%AdU74c3x,]'J;^A~]#ՎAW&SRjQ"2FRirez()IR {{v^ /gF)_m‚#%֗ބ9r'Vt0rDLPl`ɉ[##x \cP2y5lNOc t:m(۫*AYbÑjӘ瀋 ~k·)4"Jɭqob4dd(%:B ;Q|tm-'xER>b~K 暦3ЃnVם" y^kXpE9!㚒<)xmal8n /|]ϮZ},Z,*/-a}ϼ\!| s'T -֖m[ F|d~+0F?<|ral_&AF[' g&=ίgzn3X(eת=XH 8Js,Q&"[ues22qP׎Wf)~?1}2}TWR'R%ײ/Q8VJ=z;AsBʗp 5.}uҷ]Dz: a@3˙r0T=i"DqܔpVe =:qp%ݡq[ɒḢKS⟵j@?~|`͚UFRUI~ c6;sA ɋܷ8B lw߰YQC^/ڧi٧RH!JFj+HZ mo)Q :eU =qp,<; 4poy0txG *:kހP;eb'k\D5x' bˑ2XR€gb Z=k/^y/-O3i`.p1 J #s8eRrW?no}I VjlO8*p(KMQᲾjTmx!b ~N\n`ߙ'Od'뭖.'©pMTw\F{LEUZ, Tw bYVe5\Tɿ3u=یHfHZb8u 24m6,Xb㬯d`1Kblj %~c͡_Z%Q. U.ʖRḫm7fi]Z>.}SW Y9PdtP<P=lh\ݱ^Bvf>T!.^P+Z 1T\ÊX>&BC'iW7BD^#17e@ W+MP%ޠVk: CWPJ@=dE_b,eLYh[ ,RG翡HSp ǰyY*o py˵/^KDKsXECK9كJW3>яʘFnD{J7+sRIK54c3`S7\¸ FXb\dwઢl[;g,kӋ#]ֻN2ٜkm}@,1KoŽ6*WpJ"W!]"}ܒJ2D" }޼ $$W&1cpa1L{=F[?mx;47.Sq5&8Jw+iw+eɘ0d:Rrށl󹳯RVsW4a͟(ynw_TFk`MP3w ۭ38Ɓy>m9@csMvS(*84J_$n?HaV.ucƐHHFNژL4I @{fqهؙ;"_&C $ĭ. cT61Qض"wE2 n7<5˷Jr/ :olt rm%f{m2`5=NPg[Ь%J@"/:@iDSOMBS+eSBsIj?PE\ .Ѵɠ4Esj De"`.76[pj~/*|$ύh[HuK@U UObߦZ~0oON~^i┄)j+Q>d9HoB#BE !JQn'JlU ZLN +&X{S6hA_3}T:Oc8X |VOf4,G4ssn$n%]j0hh!qadmBX{$UP/t ylްd*$LZ(uُ`%c yݡtGr i:oц#={ _EUЂ*)ObYk-r))_ZܣM::+nAL7SYbjǫ77 %N,r s&oGiV$l5A^9j@SB3>oe[A\/!.hU<&==VTR@ӅW:yj!nc=m?9Nlk q}'U$=BèoIy.eUr@cWBw.@xO&K2Uɓuz?Uɦ+g(_βZOo9VENU].,gkU}҆=WAL+{b:j[2`-ȐF_{,1n畺I&,hTq/eU.,m+ݟ2}$!|ηb 65':4l*Vv-tlڀH@c1@,/jg`&*ѻ?,1zΌ`so9Ô蕎̗Fwє=/6lLQ$uZ%z2,OE:fDFSwQtbE:o d7Vۏ;ς0Ǿ&p==h60y֯t" -V?+c21 \'0Ĺk@LkfrS~ ^2̮ {ERVIo:q1˯ڨ NU4 Z7S0`&;U13`pemQaE0˯ }c_G T}e]3aNa:nK_2OWPSk2䓪h2|h)-y`a%vSNSh.>ѣy/0ʊϔo(Vw,u2n #}[e=*6F؁ߪID4}#iO[wU̷(Ix6)h8NG#e%⣇=tUkxRbC%R'|kmkuzehľB2|0wO1"!V>l~B:PX`}c+[>2ӿU _}^2zn;5| ڤ-Qwp9X<]8h0v=d ͛~>jʘ :#h35`{lKNX*‚Bt)WJ|7aCWRWkK-V{fo xs__ Ϸ!ޜ@r:|?gCYə.XrKe;-KKk|Ev,J:"͘6W1k3g8hdR$|0@?∍q&wA*u9w Z2K#{Uq#X^dg'υ.pPrjl=iwʛb$=}liXצ쒶@\,wz*jBb\"#æg( ˕lƣsG9<F2n3^B [vrņY]s{4/$JwcT ,2UW3 OOO^ _9<*\Ax`5øs5NUhqV=ı~\ڜK*Yfyf5Nddبᦼf."b%FK| Ubyb%qoXSrsS㿙}fLyBbpOU~Cx={x]-vkۣ;Lxo=XVR9kH3Z08<&A1ȼ+<+訧W Q1ds4Vၓb2C^$dt Ʉ8< Ğ-n}bo7Vӏ',j^G(pM=׿ (KutW6u;\ 3}Ư|7MIV|qVY(|<~XARNhAx[Е"~?؄I'Š%9̝Si~R4~D7qq&=^:k^ϸWfڇdXK_h*D_!P'K{ P0ܚۗ}D2 Y$;aQ8r3Z9K]Ϫ>rg̅f޻vUH9D*w\W_qd>eV[uFrG~u+C<~pM.nAsPϭl%ļ|ڢSy}1oM`(~!v>%B\Umx$>Vz9;J0|lesQ!#jŃmk4)]CNwF2J鱑;126I'YhFBS3x!s*$P?2,2ˍݬ|sN@rW H#q4+7/5xv:kIOag` =FזY(^v*=\[z aw}^ޡ F3id=l_+ʁ/ۜN3ͥpqm/nI'GQ3szP#1ig 7Gk'hC9fXm7{;0ԔO Կtre=W nLH&HD@~\ :Ѧֶ\5CuR`=+V>#l殝ct;-Y9@\~{E=y% *i鷡=1kh[w%jí.Q8Feń(/5!jKTn|h.2r=K}B}Ky~8anjaK$P} ԛȎX߯]!& +{)W$g۳q\GOg( YKK[#Mf$ҟĔ؈3=$ϖ.靤@VҾ{O? L@clWUV9ZGxrr Wy-~ڳkʬԤN#>m"tZg͗zhpE.Mp1Sum8W*}ErQ¸H)2y7aqEuF2wΗ(.ox"y=x̯ jfo%H蟤)@~?]x+0y(`zqx,P\AVx C1;V/*j?/YDizY wZ :/ws?gVyUתlg6y]!DL~ܕXG`zNɵ msv0 ^> (#;blP*Dl&V3 }0cŴ\x[5)cf(f*2d=(Ir-%Y.\쒜X԰gQܥʪǿ>@hcTl!w~C-c^ٓPjV J1J!(&?lϬv1hK'Shh4n&(nz'Oo6WHko'S'TSA| ^C΁y"ԽO;2Zߧg+$TS"IUD++U@\2~t{yV- ~?FLbCsV-}<ˌ;sIىTe+g/5fN_t3~In|dr7\WHV8ޠ--p^ }Q=ׯhd]!XS lu*c3˒ڝk +j[KOrG Μ7$m:{.תӌm3d=hzqَHM; (&vMYztY٥ȪpޣEoʻ0V-o@ TZ4T14ۅ1sfS@fʶڝf* z:Y]%wozE5',kA}gRZX1R:rae<L#UP G]6*bZOD2HJbdoBw'Uڔk)p0OŔ܋/[n|o$x)j )ҡ{/m;kA3"c}*s&ZIz)Uo@ ẑ ޜ{r|hWX)l{#/ e/vjZgY)1F!ҩ$b9r.8L]uJKϢMud}Kȉ]quZJUo +ޞZk1bp:4%iU&k9fC6i_X;=LR_9=P@C/<# KRC^ܒ۷O{gw#/uW6$Nx|q Klg>i9=pb6iOPJLzj̾7L^:QFȎv)Rn?iQAӧJ yn{ӦDʷZ3tt*)]V*-4|7NHCa:°qeO-ms_IY#N=;c$J|IuvWO]LUr=[k}JȂwnt,Ɨҏ+ui"TIiGfŽqϫ}4_0`3-}͔Ń/+81l?u役1@8EhSI更1%V<6!~*d60Ӧg].jCŀYEvz[^)EErI&u5DVi Ĺn_C9|w.lUhL8ALa@6>OQP0uY9t[՗&g`8z\%(5CLu7#@/+Nsq@ѐSpNO` fɀ $4MkCĢ,] h{R~,+4."]xv=5)2Bˡ\%v0P]sZ+H0`Ф GRU uV~BI2K ^6/vW: fѻ'ޕ ׼,1mi=y>/ Xaxq$];p/:W78[ĖмC4<`[\ c(|9/ єRl1:cJ%=Opq^gG]AtStY=ڰ [{GCܛ6.MB{z #"!|BS>ƾ_%+=-ϓٞkz)v5b-Ԝ]ۣ p<}}S'0[1~-UP8/՛ ȲfCU :1? \p2籕LeTyX֞-ץ>gTĮKAƾ ՗U!:Y @))n$ ^N *-jJ3z u\_ӷȖN^Ee7[r7є<Q0DT0 lfTM'ѕ.l=9ݽ$|׮M "q\ ߟ KbU}jbD1-*=*'8?"sv2++L 8;w_l d}/*l4zx{ }0V/8He[JȲ]T 9`\ w\E QjyP/Ԝ䴐p` VUP.2Fj9HbHO;RGSڿX~%FOz.bbL4k&g8V׶b QMߕ'+8ss6'?PƘ:0Cšġ#jK2 ,tU]iz{+T6x Yhrk῏,O!*FԂaxmgvМZnbө [~ Mɶ3rwn+tAFC4jBK2$nϟʇÿ(5M!s0&;7tzSkif\݉aͦ3PK N-훖HVZVb"b]\{a}!%o6 Nqp:nMS,5UkVz]~?OI/}#w%ɱpAێ|RkTМ *d< ް{-_jh3Ljc8F xwҐ#U~LhcxhJ hNPAe?Wbcn𞕇u᥇Qٳe lji}#awWEEamjǀ=}{ AX( qK+L'1es>BH2 4YUl24KpԄ ffqt@fiĆ լ`i[SB3xŁ,wФEdɇj<>8IvŏXxdI/U:1v>3nb|&⤧]6Cyb4edG[u2+b~X2aFGWi<0㰹1)OtׅDYdJYY4I[ri9^bvg1-fHZTqpR4S,\'ޣqn"Vz5썼c2"v]Ǣ#{bWLd 8R\e-ٞ9J"̎3eoȑD!XGYx`3C0f `O-/b#4 =yKݮHke㥕9CtH`3/G;:cW`ʳ/R?<һǝ (U# ]{hw0R,)!g;pŘqՓ:y*81waE"Ώpg3@ 1Yowɦ-|!J-7 CJ9էԙ@WWGC]Pso%Vl3.+ѻdR랱f0h;[ &١|7uAelO/*2;opNvk/9~X{g>wbBӌ=2r($.6N?Nis-,ͤ\KZ.Ęߋѳh[w]-hPʞn\2/.'+euȜe}51x,gZj-1woJ^-Ki{5cv2bYlc8زZ|M?$FWl?_5Ju$LD|/Ž>>2痉͈^çLF6szŵRI}T_N:&3$'P2]!`2/ED]q0s{K/xQxM^\"n0JhUC{QFwOys;\Y]g}\M7CRjvv9Vg~mcsog_=G@@{s 0:a^ўG@4G{|]&FX2nqGUR}QNxrdu^$lOu6?N!:?ZdJ/`D!h$;l6Ց\G+_Rl-r ]rᴗ.ѥݡcf px$҄4ӿҤHb d&QۗM}GG`Z$hdڜ0ퟑ1dU48(`V$^Wd 3}G.&Bg}8[zJ?!v_ZE{ZU}bB(jm:EIYhD8F3x(wS`*0i ~Ofz6\hQ{=^I!m^|٣,M _C_~-7R _Vʌ$L_/t DŽv"8rWą7Oi'L_:Mx1s%j֡u!u%^EnM9!-ya+~j'rpڻ} <3*vZ0"4'{kZ2|)T颏/"䄑mBG;Em)ł=y?dkqO`1&l{V-Ӕ'xp+Fz)>{)Q㜝lN,`)tx5.*$ZoZjBdУG;J.Ywjc>0LۈOX^:Ina 4}\pBטQ7(l?EG!*7%Ye1`iqhCk匶fPݹ%뜚72Py*S TpX/\,ezk2%& ^ \cP>G$_(+N{:?NA"bD<0 %fu:,"#4K?\|F|e:ͷGi Ha_zI+͏ 畩^t˻+&/3]3Uv{y;>/;m2bW.U) n^J- S($'R wDbmA0Oaqio=c[ЌbrV5r!D#I.y&rL.CVm!DbtHCa?]9 ú<wy9Mܻ>\_1>9Dΐ(k7s.sHavDDMo f4BwXaR)MY3I}jv3Ig Q Kl R'⾥̒EU'8u3M/,Fѵb +{tXNbf5WJ3ԙTxF(tyLh[mdžrX.`4k-9f:&3)NtY sH.؀9> 3[u@"PELM ·F O婀r1qU 0} I”rC=d(7rȔCHOvOW/y(M̙x_1I(^e*IdЊ~5@ l1*툇Zs:i\Մ>{P֏&ضVK2+^w&<@ыGl^H]z׈!1 Cwzl8*^BL~q%3I..*a`q%Ll=QKl/?Qs% ]lm=Ȍ4Bk.O_oDF"Ҷ}6*D~v~"h<0TlOb^54m!Ў#).+{܍8U-LxiHҢ!0 TTY[9h6l ]&J_̙wE\:ji?o+yjh"/ (,L9񞥷m2h^{ Yz&2Ǭ^Dgi~U?;-,_΢N1bt٠)jȼc9F"5^;$Ղݺ^9QLxLH$Ѓ*'ave.7 MtL0SwEב%n}kafT->=8g~spI ȧ&o23j}o&sP\F2 O0B NT03Wo3cnjix{:\:'m!=~o8|7)tQHشp9t;*GEy qS$CZIV 4L+? zr燼,ex4!D)H%A_Ɩ#y^XU&+@X]bM.fJJ  xv[-#J08Ӷ=G!5|F'TvH`I*xe7%Hm/P1|ut^+s }il?ˠi x z;_⪃(3T_}2β3Nq[lO%t<ۈ: %}'1c &'Z5&-&N{`c̴l"XOפ0 |f!r <4c>: &v:@[=7>?8fYŸ ȁ[uygX `R;r5Pgz⧃El Qb4'Е3Pu`_!oMdObFvNKC{P-TKRlǤ$DR[USIQ(O$<eUׯ#91 {1ͧ^nxtu= \@SN?&GYC*m. E]b(^ X?3 tޚw_L?YxV}~٢ִh$Qrf^iD|![їH[`gC[g7 ϠG2FXk!6GU~p!K`hJ:Niґn ?i,&2?XThH3nhIot ZE߁آgAQȄ_!OT%3 0>XR)Z:GZ/- )Pu//O3ۨY`/. E0nxRSn=t-H@04ݍ(@ug[bmW|u~εԞk_irnvU(w*>*Y_3xkkTPY>XDs{H- 9#"6A*R#=uv AiFC`0cy?߸0$#gP_&#v)klں9mڐ˜*bS:qDZbu3kΚ5kr2LdËXD˙HkAˢ~ p)F QOi0ӄKԺgjvG6p!e_|*ȗYاn=1[>!r{Mmh\2Ut; mƇh}CMx&v ̰aB.6>1 gE}=jBo̜ULӫ eYG7ZؕajN(,U)uc9u ׅJH5W4O7bn)C;i{9WV"7x *:3B~'<|؞`pϩD87ffTG =ixB:.ʯ.)$l5y}!-dFcX)h.XNMZv~ F95\<SewM(qy 5V I a&+c1ES{>,W%w=|O _wG P{.u3N\.2_tʨʞDs 0HƆ"`Bw[iM>@et S]L|lsIԮ7]l#2/rClYypZ1vȒ%B}8ZXSO=c$s}gI?$M!hxO+qCapQ9\<'XNM1 ݤ{3F,|[ .] z)n. 3X3NAٌf"*?^wؿf,QOT9|Wλ] !b?nM~v~ $TFDN"4wYdoP lD<˾%:#/OoL+`S)mnwJqKՌ_'d3y.ܝvCapyCDаtf`B].-버koCn[ KBÙ6 v38&{cʤ tF8Xf{j)q)ػ J0)/=yZCmRmQQfB\0Ґ@,Y5\3!t=z#daBGaj୥cJh觗ʹF,J0O^ah{ji2Yֈ(C&Uh[zάd^ ?fzˎݯuqV-%ԔIK6 s*6MF1| :/ʯ-R/IUqIl y5$æxC}8Vls$y8L?v~R S U㈷CfT Zw;X;'"t#‹o KzqzEm>!-߅u2쨍lEIJg{˩A5' S)% w*K_mkahS9"Ϻ^tJK`ߝ95|-#aM{=P&^ 7>AǓW_/_+K{nWTtWRZW3n G@2y'FEr+MR?/+񆖽KG CރU}θH(ɹ:5FGkڲk%58:wu_IvijC($H?6!|K uQYј9w__QM7Q~1aŘ\S6K ]M=)o\}|drv_3AkRlcχ8f r0JeoqY=T@2Q8!zN~zփ"L%jsdws@fL<&\Nljt;;]؋0Hč ŭIPリYXZ~%ΉڽLBc6 f=a nzDסPԤ|se#a׆xO\d9K>ҋx S߻Bgh.>8.<^.n095~nKXSnNǡYxLՎ\WWq2|D>GA[Ejza [sؗAsa=rD/s'D33Tax赞7Ax·iȏE &~yBJAcY$(ϒ7FɳO] PPY?45)+ᾞvUkt9lӪ$e"NX.-9?ʷM{K㘝m2EcFX)8yQcqz9 x!_&hF]&"*Kْm! s+鞤5{C=됣֊k@9@xoq]tl Ѡ@0KFG9eدXZPZM:#?y⟛3!h<, ueA k'u=V Ԧk#Sb`^eؾ}ǁ#7%fikd6:K;c{j\`vY#&9+x%8,Ą=ˉ .h·BKI9ViHvX& ۪;Plml8 渴5Ǘ\ͽ*]N¤k\]AHd=LB3'̷O寄'`kb7ΈL{`8-.İ +yUSbeQ7qw FJ뷀m{8?z_,nO\2BFPTGg**zm2HM֬Œd%opR< sylp4k(|}m+WjAH~Αaܫ?|%bt`iYǸDOIHVΔ]l M4ǂ3:h!߼&'vIɛ8nM@n5F_~__kfnYu]D~d q&Ž[ʤ&HɸۘErm i;B:/RДTQ/WԀV뼞]i9㡊6o4F_g`)nHo77P9:L7w[ ]-' Z;Pi"EoL+y9L?lnn zٟ̓Ą_|Jcy3F( Y5:`HB׃."j(w=Y:wѐ3 -#$`TЭ;VI V.1aؗqwаN1:=da]4N6TJW<']d<< Irr5Tڦ!h/+jU+@e{V WƮK/dž=LZ=?̦I  ns;a.f7ce,ؘs^LtQSӵ`g۫)yneK",p\a  S}#Sjq2?07~ɐwPaH{`x6_$4GV&/4U+ܛ$=cEVRU-6Gp+ərHxĩkU(P \0CvI{H+o҆\p#zkqJ)L*cKs6tv#0iz:Z\]Q+b;Rmhu n EȝMgo2:/߀2C|Z2sY5QРs`%; aH?Je^DT3U+9O"/t=QB&O$t_yeY]bv"젂)ar ,5?8E"#N@0:a /*>Іb MjF~eQ6>3ٵ6O 03pN,Uxo5 E񏐙U?J \.ǴRS:^Us*9CXv%>fh, "om(IM l+}}<QuPppb!?9ec /UH{Hݐ颊* uM;'_1utbd<rwBd<7@3fMNJhCJJQ% _C%JpdU1qAT>-}+=RCB-!OH uk[Y_"v іƀݤq``V) ۮ0jHm쥸: 36j`o褤ĕEsTB7bAS.(GO /T4gEuܙ_HsgN Uƒ;gKHV452by뙞03uu,mVz!`lsڱ# <[~ySmg֭17${CB,$y27~oYİ9)\=Ӟ]2aV$_QxV$  [/&ynWQ52ֲCE0"6J+lERR%4qP'W Ymbwrs: I+]hǟڙ;6w|t Ŕl}d4trةhI"}6X>goqqonnfńVN/' ˺־:dl"e؄AC6$wn3 *> A~+| nh%~LD? yX@8]WĔ4"/4|y\U6?5w;ιҨ>eieMBVINʃ bڏ-MճP#XN0ALv9S.2Bb-Kݨ%j jp6Y^tqlOl- vYhxS=Ȋl5*QjKn9K`ݦA/DQnAf)6-o>IB$q}TاT:~} eqf+BB1qʺ1_^ PGnNl8`*]ݽ}DWxvGZS3|Efj(\E.";:y`%3-?KϨ']aqVl*g Yr%5$ IT-Zp5M0tAgJ>NE^ [EXΝLq6@@UT{JX_u%بEer+ څ84b=QF~7_t#{ðTj. E=''GއLV.0ɥſo7QHH쳩[I):Tjb<1&ݾɝI| ¥q@M >ԳS?w $Oԫ#U0#)b`]\reU5|ac~l:|_poUoZ"d&:&+B_8r{6q J]lc:WފG:ZLX7ӈee )/԰#2x&f )!lJ}W:U5fHlVt-Sv r@`ېDaa&$#~8fNG[Ld9 #8󲜒z7-n(]o?~^4C(ފ^_mZUO!.vliRch D H馢áD頲SVsE.}' J;z 3JZ?QLn#7I菄w% }#,]KNZd6#8B>|r#ZÀ+Q z\T&FJПxDG+Ն.ZYCmU_=PfbHC5Xh5ފi<huBG>/mny*jp&u=7I^}dVh@۫+ U6Cm$ Bm}[(׈Ou࣯Q+;%=X(\DI+JMɬL˂ pqږqkn:B֮ zkbA܋W,U[&6i*hnmyƅضӊ VooY,Kx8 +:LWr0IھWʆ:3س@w]Bqcv D?k˷%`cM5m7'0wNEf#Ns(pɭF= LSS0melDb.WT|5K訁nۊ]WoK]?|8d7B`?~}6Sp0 LV߉ZIdc 'ѐ%[To MiB)^O$km՟A^ϗY?+ jf ͪEM 'GH6T`(븶ebS'K(QUf4wEŚ  ivfw%K ]ʩ.Y Lf~do7䙃:EoڡF]lR4kzdS) 0i3UΟS!sJu͚)vFOX\ .~HZT [_jmT\6@%ķQjgl{"2^yE8H!EWR xE;ZrZ4[>C[B!K4uW K"aW8(5Uѝ1ߏOو]"풄`DΆ?2|q4-lˣ*K51HMwOsBV˱CA M ?$y:) e > Q r,^'gȗ쬣R?aYxq:+G,@#G +$N ީB3GKYgCd SлxQd&-f +w= 5|d+sBύZ?գyF&Q[_hȤg{vxho>ͅ@ uJl%a䷕ʃk7%jd⤞– "Yd.拵Bd}}3KG-G>qE}ʶjfi ֎daIw`@۞Z">C9 D'5FoЪr-/0do7!eZ` xj/h8WhLjqm,-bhD'bWɯgw0{ZTD 9l',wa>5f4[jI~u gBe ws3k_X "d=0!=b2pԾ)iE추G9@ #Nlijg,{ E?f:% 0G}AeLYY8rkۚz++Z*泗!!;hR{WTp ?\x s&p xǾ@ӅF}}O4rR{e91!Yf:gi*<'/M4= U[*3769pN+: ?eQ< ` ?S <9)]/ ;ƸIv8S?w(z]7O`s1/{814Xd;7aU`ԶU#۬*M$rno`cO+0dLxOʂZ\O] H DDqEzoMTaM w4:aƶQ[,Cso`IkE5Ӊ]6`:µ!lQ5X-k(eqv!hNK&RbzZlǍ4yANr= vC伪вkP13=sų>.6eOd2n=N$pK/|T8Ud§j9=9o\|ϒ!pt gk'e̦>^8k{mIV-QEʪI(wNF1_6i`6QBqU3,RTYas-:JLh|< ڕ5EֻgK+{;C3{CQRD .Ey+i)0Zţre=2n Ŝ`V/Z*eR6V#xg[k Atm- ^RWXK4Xx=NvtA ;2yIru;j4B$]ѥ5KE;Lm(c!e9}Xҽ-Ҁ{RS0n I.DlVĨ^1WQ!(hw ~cʌ+ղ6le{KYzSܰ=nON{Fb OؘL rbD`W|Sza<`XL+qCȎ! @ `Wk(|`DP J] LCtd$xq6]X@8q"ݷNZScڅ E !P.yt:}3<6VNǙ\?rhHWҰNm>-@70(ծt1dW5'rmUߡ*"Em.tѹcd3h6 s7cMw˳%A`+r>yAީII%]4iZoȏCJ{SW]+Ӗi4dXqb Krޜb(}~6yZ4ϟO]aKD}>I? k4cUeZ0yHSO]Lͽ걣+ A?:T-l=a5O)t0 PhμvB*ܪŠpSP[ ˯3@ӍӅi o:^ 5`,.:,?xA|+Ac.yRi3Dt\DE]a- n+K/<{W)û6}SnXxs%^|GZV_Ң$Vt1 ȉF+ywAl __FO(d +D5_P8{x9 ea*U&ؚ :x>3g^X[@Va3x"E|რmm2$@HA%=c)!k֟xTd>+(2%s<ְw`v̤͌nFʏ301ք]T[NyGEr@LցawN2L>?- npP^[b kvsI`MLw¨J\/#F|.*9H~-c]d2͊090)'*l$3ERt$[He!R =슆ڹ Mc.9j^+;o)Az -͡ш[W7A|#wL1Baom]k42xmM)aAX/t֛T+M*ѕp~H1 B\Ny!,1ʥ` ҃O X{:ac0},$j@ 8"1!c3C5$2,TI ,@䯓>O`Um> 2_k$3pԎMW(W׃)ІGN< aLj\\{}5髎:}*4 ŲLO}t:="A)dMJ_Ǘqwc6=$ H# % &M3_XWFyDF&t,EbP+o* ec/`ewfpծ9ϩ 'Il^ ŒvjXqk[[&7¶{o8H` CU. :РdXvnRO3"XxǸ5=0T=uqqQc< gSYڋTpo߽=o[=V,G&03x\C8H (W1F` =(ǫx(TR[u9O|AHfu~/^;;UFafx ښw9GQ|0|G^^{ǏـQUD껩hCDQ'G\PO"6 Iza|@0fh=4'SmEqJ[vл/,u]I%ω.J ^/GrՃL&yn}}~n/IX-D:Q=۹lNLUѸ6AZ$.^o}@:9Pƚ儇aZ/A5-a0dBԒ%aQ bSa :msqdt(3nKs[D9&. bDcC@h.6! ,ReSs7Jy.`H!v`2b {{a<| 2;U!iK9wcZ{Mg;iv*⡗}qsSBb0*r4qs0mTXH7 5GsM)R2AD*\$bXeǝHy^:㡾sP*v1:Y Ce˶%%_)dj=BA:]yjō.NQzb7H19\0ż,b 7߹%HK_d=W;!ΎAQ<чx_B6H'gĞYnbKhx$J.`DnR馔԰bl%\Bz@w} BOc7Sy=0c7q< G9dYS8Y N"zL`远v!BS^ Rp':ܴ{'LCx m[%B_t7ܕTtI?+Z+۳Ep*G4d#g׶)O!ϊ`;dN;=Ol'e*rIBd-ܢ k3T5x5T֢,c$⮁h"i-rVdk)&c L8|af $ԫK6JӔeFOfۢiL~2#O]k;{5[p]aq:ɍ)%Ʋ͞#[}i0A^H׼I2vW j3zcu3t'EѳmCbe?]N)]J!.@i\wzSyf[ΪB KhR,T\32[F0Wg"7\Nˆ? Xaw/.։:! r;|WBL-`tT(B 8G l :(I Ԡn]x)-7W\U"'dU\2~M4R5I{4uSsF.,v%r(NP~gX:S+MwlLn/(}|U۟G0G#E*%_.`k$ *qF((':F^A ?V=S7(4cNAK[%8ҝG@IO .Qml?CJ Dl5v/}>e(`lND`;(sxӓۜG̑o[GHNm'S]?" h1 JY^j70&d tbuŇhM_knjiҽO9i=?7i׾.m$$yYV\cLە {8n^?c}f`4-ن=QewQo`!N(r+ᬫSAXZ5g/'Da֒kvk:XE8) OŊ˚H%A@Ue&WW|RUuL%~OME<1pƎ8YkUh"Q9$/FqsdK-mCGS;c]GRXl2YGF' dj':UhZ o<Ԭa>($]5ן.j62N̓?nZR06OK7VXBqf;f?D%N,/ZP|QFMv}/!H1?V'Ř=k{GDmbﱿ2x엤E@Ӫ^)wy;lkSn$22 7hJA0` [9gM+ض sxg̺]EJilmŅϿ>0xѽuXs)8˼W7QEw, E.1Y$srK}{KoϺ(E6N L4m=Yh{0lB zP,q8>N{^X7htY5^\^xuRRK\_}y5 +H\a&XhO *C.t<ص!8?˂nPX&,c%7[ayuS'ȯ>8iĚ&ͬ|LyuNw`#*"b!҂+ YdW혡HR0<(/,lNmUXN$nO%Q<.9V^ڰ~,W 'W72O7EM"rJ: fjY݂гhqkB+Ov$SK)őng&eci02/ AEO gԀ> E1=)j&6ڗnJ_e`upɿI۠b,.ZM+/B+{fm'f4 .Wf, "3yOJiY=l)eBGT9Q* z0Jg>C1ڠ낳7 @#zd+oAWhfŭk& b:G>t;(1Pb{7)yzɝ߮4f G||(1( B/-&ybOmDۡru{^ttVS=ˉ5 I[ۤMD{?ӟըxYW?jap7V}NWJ_jZuYDJXڢUX2pO8kIch>q_s"]h0Qk?E>Q$HE` vV%i^/ҷk  ٱM7#H8%x6$E2}!Zz62d/;PG~1 ə+nXAOX )cHYO?|F6DʭWHgi8 ]d/7=ϼM4PۗdZ`)T±ޛ!ӫ6D&Bf:i `1eD j؇ax(߄ %TuMVOW1eg+ a:吗H{O#| ~Zov`8r,d,PD0F fW 7}$-˺n ˌ=ÄD^J^,sQV>LM#KWtF<%M,$Wb:sVh|s>';B*W"USgxAcuNeRk8^LOaRe"D@ϻmRSMD; l|rEu]NVw96:) =h1 vr1spKB )Q{P:= N$ŦҙyU||y`ު#ϏıodܿWgMy  K0Z(#EdBC%)^-Y;.;ƋyPdD$U?B ѥ.jg.Yd"(SX/vڇȷN3HC/YˈG8Pjך!+9n1@}N.sdx+"bc{NcIS䤎EDelLf41 8^Yg|@cG\[uD5gd_(rnJ0ǎ)"3<56߻)C]p*oE|JH?Ohlӽt Sv $S*DH"KJ:^Ka|w4GP.IQ,dԜ0ԗp,5h ^0W"tY Y^Ϻr Q E>" ZCz;$+t,!ul "9?qwyO.Q* |sN|n0Hf>5J7:dj{t Sl⿚N0(~kY@LʭPsp(;?Mt܄=lh8_%6K9z'=8$ K[g|I1`K!'*QA޹-PnmQR*UonQ A> oxQzF#l3"=O G^EX۝N T[hE&:Ø%8!ER*RԼ4E&%w_|VU; |%wVO|z5}ӃsXR+8HjeqkLıAYp`U)>@MM )2>% p y_kTZOBeHj M%9Te!$ztDmޭ5 b]+㱊HW*O6Tdxa@εRaUoޏG.Lz0$#$}4`9{7e况$լ\ !GEUy^dep^Q9nM2/ %V dgGRgGJC$=o MR/\BH #ũyDeKM]vCL47PU0{׉ZnA|Wy'Ayvܡ6|~U1cja~j "snvH.,̈́uKG 4p5P8mB9 Cf?mx, ?0ՊmNz=׏9|eف -}Wi9Jb,ub׬L mD^|`SC'4c)DF-%P6Z[SI =&J~>?'fKqKWqQ-raƥ33u! L3SLy--kxҒ;ۺĢk!Q)l%\/v"^`$b'1O(P~ B-A\BF51–f1yVɯ׳ϥFdzQ굿ՌSx~ NóF\,ziH*i$*XVD4gY'UiWWQbnYDFvf2:ow*n޿رHC;iY{]lzPWQe!@$DETIOh?m/>S,N6WwׄPk~.٦ 9n?.=Ag]*&(T-.վ!+-QR%z lYTX!s'w}Q?㝏!kQwB] C `{6KL qUî<pF.zɣpOïJB m/ԄjeȟGcĚmRckpKSͣRA'wa6O݇}$|S4]z][4@m)~Jvg؃mpM/P<j^j?N$5g-Z2NhFʍM\>Ÿd<ǙA>;csf܈B)NuSgqV -?)o8 @SP 8foK3ӭp ē+=Z7y8 [.f%娫> tm+xC.(ݣ1 Rt;g8'ck.{]WSOjt`΋gAE~ÇR÷Bbvȃci1M9#eCdO:eUcΞM O0HFNPW^΍#1{m:֬tWyM$82FXl_D4H Єz:OtNuQ31'm[cc.u-1`w=n Sukm#%Xޝ 6IH6,D\ 2 ?ÿn7 χZsQTo{|HĬ+T?Pl3;/_}(x VXI(=Oh-R\ȈcE*u|BJX0gWag1Y0y8 8Qv$VKTf$le+ :Y Y?F~CÉwB'd|1EL;JǧV9qjZBBK$=nOdL4 Hn5|Ǒ֕y{lH6!AY\YS"7Ǜ:|3׌> , k;J8M iں: 琧,Dhi HTNtذ֏@hiR4\@[&O~$mp/G LWگ|Lf|Fbqm7G |j$UGMw}聺K@ϐ#z8Zb:# 2w(/7_$ w%!t<剙1WrLqJ"&΍-T6=8;#%nUzJ`cS21iCV^#>$:$s1p? \_@MO ՗'oW*4pBd!'fzB$Pr j{9X:I;uc|"m z{L Aӧ& 7zkc w{Ns\BdMZ,;VPw?"(I<Lg~^80s}$ץ r6Q!Ig#pSRuJ[Z<~ Կح7ގ맻6bOuQd{<7k]kA6=wI]Gg)14-!_q+q#g0croH E͛xNDڴP1CFrrƻ=B xf>#sC = $iy tX n< ncearr6(}+Zm4`A{2fvsEW\F}Oe~- 90m08i~3# 6̢4pRr=&sH]'QZn#_rܾ-}.%< 'Rlg:k`kbG!r[{"oXuP⤷7*AyC4HS8qA&G\G |>c։|E;7CtQ$ }m=i%[+!Y=&6|/|B{:4N~)ҭ;I}\-҈鹼,8O7E؃Z )q TM#6 { $F$S8m$QMqi-G:'a)d,]۵*-Sݮ Nl󑽘'b'zvEZg[ǘl2@@RCT(NLL3" ~ r]k"f} & 'U` KyHf"~'?oyxr #">Vy#&vtàP8I8`وZom6EMt>0Vs2]RJ0 7w({"<$/s= n0v%XA$>}Oyh'awK(| 1稶"'T{I%Sٚ]~ő[^6Zd^;¿R|i0w:}ۣpXaԧg2 虭CfH%tT}YɜCm1ݰ7rʔӥC BD4TkֵahtmvU`Cº\~t-A5r{[~ęR |oՒzթtel>;V8kГI}-nT3-%m,YtE݀OYtKҥ>xQGN-tԹ;iI;aI|pJIQS2;w=qNéڬ*N~Yaۡ_˖y_a=\KJ/rr qMȪ~H7v 𜓰~ἓǘ&d*'`~Phs2`~-#h^5_wrOC=yq.)]m#NmqRh/*ЬEm̦J7r/gau$#_(ڳ)$"98F[eRj%8).uxHuWӇӾg:|%Jl7$X(vdԈ1e tO}p"Vݦkѣ$ftbcuU:]! CjpΩ' [FAqbm_nBR zPT6z€6pbsY}Ԝ[ z$3z HXRPVvjǘHimĮ}]JYs-b$j] Z3=1 ?x!6? ЪC"[oP@c͏hN߸Hnmm~ʆOhK֛NHgv-@uM~r:jt Ʀ1۶#M0!ph+'<8S 5tG/uHq홐eTiUx5xDU~Jί;\,W6 T${'nAk vuykLYn [7IKU :^6QP OFâdQ4z.}p&lf!4@sDw e+EZu$uH[5@ qN';ɤ$x@Ml1rpg0#d0#1oZr[ YV>IY97fY՞TTi DagԿ*WfY|4_ZB JQI*`N`q'RTVwt[!F9I%鴫~uI>Qp"3Ԃm'1>onb nObM$,蛗Gw|b +sz| Ljė2eϱ_%ĊYE甩둕e4iؤ){O@81#M :>e<$z׼GIVAum.dD4U nIdk*qD|CΥ$DLUB̵H1& y'&/ne,]jL4qNTCzDшY.OzVW0+*iVD014Ie^'ʪF;G Y)zRrcҶz/Pzl-β^̹0jUC%|7#G4"55&ܷ*j Zߔ|±.B!ڪ3>2r(]} V]" ѯtn/ED^.iQӹd#%'^|Ægmt Vibwkm$L HK6mNz.9DVc580~ :–aJxj@CԺcw HX԰+}}I>vQѳ6l!AɃӱ]@39>܅YNC!;tKtݢM4zħȡK^2ձ14]X q>|;U 0ܹ=w}&/D| ?QxȔ> 0ӕ9bMXtε$ѷ}X -Mw?u);u3_O,N=V%rT'(m#XGWcxSsYNL:(Fˆ],1m{檍ObVKH˅*PJ4>FC5:+_X9X# D^!I y4]ԛVt2f"t=КϪ7ϒJ3, jYzq iSm&UZqj?q>vE謵v+qLA m1]/}u~)kRcPMT%mӻC oAye8ذ>o2 qYo82_^ȐIy NN6T`.#6p}+^Yܔ;tf;DH"tnV #z 1Hj4\"9FPg]H vYw7^8R 3 mPPإRc3 aysK2uzF)|PSˠ=*([ {b˕G[8'*l&Ւ[5FKN:@eϤ!Vfp~f}(/|E̾v;GCMڲZDVSp*<.Q\0rw0yԮYd];°u.lOGIa:trH!m9|gY"e;\ѽq {`zz?"fn&x dg"SJa=[fO4ؑ q!MGQ~\'׽wPFKIώ5O4<1{Fanh`bߞɅg:W䣟oҠ4mVOI7TR|䮲7fdwuS(4qHlK #vY7+@.ɻJa{ꔓǰ&*ĩj]W#*zjFz;7gT%rQi^bҳV_۫ jސ%u2}ÑepОɗh&,g›в%rd(ABƕ/ҏ9lr 5mpB`TJJffS2ϕT8EϗIU{'ޤ-wwɍlukVfAQ=,p 2۷(]{%J$,`]iN(Ēqd穚_ (%\qǣ/bJ kUdȫē}]Sr`v@$ B.-HưiDۘ5jKqT(tZ ;_$[0< ݐ55%_iMH|iz<ͼl`$iIg+WX-_~=.jgvP r,"}!N~筯q> s+ UzH#\k8 /jˆLC94ЈԲ盨zUS; =,4ojE1ژ2Fp _Cص#/xj(1yɯ㼐:^m\ B~z3bG\Hi.m BV{u+z ɿv%Xε#k(<ωu!NrHfhuutY `7`&{)epRN mcT+p&bmвKCz}2!u9/֖C0FN?x!(d\ 7}ÛOcA6[_f㽗q?E"NqV:H\m_\Zm"!JlFJ# ACSLLӑgDל+$z`k}քaw,B8\+h#i Ee&Kr-y|)\L5D:?WJkkeǺJ%`fnd*#Ml&2x׈|T]I_\0;)@@`h!pVB _-21sH5Jﳛx M4Vc'GC~rβIZ=< 40JTq\>C-BQ"}WVfE|?HXހgF^v]FG* r[2)(S_z[ pکekQ\ H\Ż, ? Bo1> _c.AK>w JYr1g]#lrM|._S߆x9u I3RTɾ`LMpXT)@[p:YrZnT۬]I_ \+גs \G;{oa@.Tp74 Ama 6a֝~ވ/0EP1&/S݋fl N긋栂񫪷Iwl5"vb$ݶλd%!xgiF v-vLBƷ5?#أw&n`<7`j*22o@Z;ϠP_1-%!M6kLaI6^i@p,! gWl&'.ov:˟\35iԛr.Bm ^T{!UewX KTM|d6ВY7A:4qa@\3WbboWxg8*GOJ3-eds-yS3Op^|nrSjt&tn=LHkή wDb9,\XJ++r4F4JUM$pc<Α5ɟcxhl`JP"b1Ƹ` [P4NB'IqXkh67iTC$bcn(iv3.0E_X zdp*x`1 <'{e 1 ៼grbW@zt nܩ)uGʟ_W/rp͈1I5rfHPIb9aSM NܮE-]> ls#MJ8kC(5ɠ$}$'^dmj$X#_[B bɆyy#Ԋ|3X*SvOe#5<, 3[ `^.X͢;Ba~D~;?[U^P:(0-+_WZk.rgq=t:; Ko3^zNS.ΒOH8;w~ {: BSm0w~YW^Z/EBMgxjo 5}ܑlrbV/0ʴrU}캂)^wbT ]OL] l쪁ײKU4 ɡ.̆( H6`ˮ'|(U&#pZF͇ߤf1qrh~,ۍb,r#2se;aX/UxXVc )2ZKM$e<AIf #o[*R]ZĆۦ h}xJܤୌ9-f?/QàuϺeS[ߧ,lc"16ٱ&CF\X*Trv2L-0{f=^%5d{F&%ÄfU&)MJlr0]Wa34|Ӣ[v3T^KE{w PbA;"|43ܜV莸P3wx2kxV1IҐ&0.j6f| eAmb i e;w<-ߺR3NJg"NXp wBA_Wz33?4Y|KKB*DڵN];疾Ž]怑EoQ9 r*Bnf/jIbgYӵH-P^3׽yr*Dt[T|8rA<~T,d^&; ~ʻȉ,&4!ߐ_!N1ȴZtDmv5(dA"͵]0h`3ٺ\wlyyD D|F-X%QILH׼9Pg` ]B$l'4v%햳^urUTއ&=W_SCKrMą; k!,n__k\{^] DQ @ 7cKm /y1Oqj?7j Lb$^ b@+LG)23BmoΚdeqW\Ome3kPkhdљ5GH KfKiVDGŪkxI61Byf84!+ӭ+&% *MfUk$z*$N*wˏ]N<.H;r,3P$6)(60ze`}$<[xSESɵwaB7CjE~(e:9etнv$1 +N =l(!DXa(qc~fUR/P9>c8BM|[m;ߪt(*2HM@ de≿/OfGi~@kA`᤯JG2ݟo 8@y vʌ9?h4_Z^(#R>=y)^x &ND־]=YXf?)cbr** z&6pcfp(@87N֘BԷ ^H^v#b>0F8 4OjwvFlƏ;;ݼヌl9 neNf'wo_hΏ!_AYC 1J5t'ׁXgpy@R-q5:3¬pBG9:w0#9Rqp$pe#$ /~;2K@Qׁj} 05Gr5u'xѣ6|e9'hvΒe7a} >2U##NuMQ'8# ti~#c! >y;HO 'GizȱB#xPŒ}Gf+k]aǹ>3Fz;,IssU<ʩLyBi9xQN2 ^ţs'3Uemv sn>טqj'kR`zˤjH?clh @RWA\(~(E0Ju{)ϿZ2)#Z~r|5k$߁>{2q)}I,]\fksR#KC Bgh%kB=ۅ ܬUئh_'_0.{j*ca+#m^w\#V81K F< 쪸[$^OF )>7ϥHׄcn\|A6g {pz#g_~9r2$`Չ2MaJ'$=> _e|. lU# w48{( g˫ lXhCc#*;E i8Dxz)i'YQ*W0ɏjZwC0QF̥5[`R1aONP$IWXB Q Biev RcKzv^kE#6gcc2Şv bTf 4\ It= Jvر3/,f%؊ĔH<ie:@}.O\MnjOFVa%6lV*b-(|YaxM&>ŀf,K_6e=/mDa~$&14InC[!)~ ^MH:q'+JWŞٲz@Ms*4`Z4q^ bA*i\48WVL{-8+S'&aYb+}m]lo2uīg`mBs} 8u[Łce|,ru#7P7x.- E] q6Šdz$j?~g~#asFΑ9ј ˹۝=f)b?)i6b|x+//=92ЇvEV ]XQA{҂^Ouĸ" VB(bU3W_EU*GicH ӂ6NŒ[n|x̓E ,ŁVk| }z%)/ZRkpFaZ|Zpӝ>-/Ntϛst@' Ml\(IcwdkBf7ơo-, Qm4]f͠q\1^rrD 8 `[{oO:ǀ9Su%|34&q2 KD eSVi}=Z9hfMZZ6:DbY: FZB~||/u:sP~_Mv9Oq~zeT|HOw-zt|Fmxi<ؐ,-0;[_v|"ԸwdCN@T.n*4Vs<7(A#+A!MC΢@pNH \r䯦Ҷ$a ㇆WuVhۿ4TF{ /iRw"̽ݡJ-_[0ڈd貵3m_[r5+(DEbg-)~Z VZ :Ƥer$K>L_A9J|NnJ*.yo;,פ =hzBfsmi6<)W5{)dlÀlʈӮD]>] DY&ۄuѐL􌏲c~nI:Ɏ*;dh[ 2g] $QԐ7pÜtOxK<)@x\uJ"L@WPT! gc :ZM;cEoO{Pf9G (GW CmG\5EH }CNu "y trm $ 1]vY}&(=AG}];bs&gs3/?~'>olfG7"'-~gt( Z(V=RJ?ALS䷗,S&!yV-,jL򜜣7.0njsI"½~ri`opU,:x5C`$oR I)DL$xc1^#|)h8s?_fG{2٣\tvm@.@Aͺ?wYJ.}b|Zoէ9e-5G  2m?;fP /:@b>TФ_kPƒPF5=o2lQePඦ‚JY)ZC[S3Tj%(YCDQl߮[RD(AchҶWX 9&աH1N8a#q+f O͎|p}-ɯB#R+&I(n8la 1*J,:o1T| 8 gM)EAelp~>i?9UGXʥv(GLtscF4&u Y0dCK}I+ ϒY;2Usg'/A?ΆPs=|Ѳ Kua8 (DZ]k b!71'NbTl h^-YQ6mG9XQw:~Ep.$5 ;5<#a Qz.K!\HƂwaѓ=aG30x٨+GOz]!.ZKU=⠰ȸ[ "zi%${V$oFL ;.<7z0A(IRc; M yђr;}!Rb !%IyBZ[Z]ssϭ[ MuY7HAz;>?ءm$̌ 9=a\rP jF}Wʗ?IDZʳ$qC/󧞒"WgRq„ 04T,"#^tznj#«}iv[#5s[ ; hii54`+ ]/㟥E]7'B1kLٳ1R J¤X=)M] $0`[cű:bEK?$"tXۑ*XL_ _ ݊%cm0ɂ(zyT)u6\#\>-\m9!t Lm47M;fQ:`۝9`56Ёb̘͑e cQ"M:. !/]M8۸tw'jq~q,o@O:H@tbϢ_H?݉` 'iDG*3Ip:plKz6.AU!s<: Gv(:%``b3l3+ƕ\CTYl^>YvpO↗ĥ2u0IEQ tq|zpo >5p n-g7;t bgdpHp"nBm n( {8GE'Az_mGpT[]i`) Ik]M_QerP͖_:vO_w]CX)s]"%shi/H|/Ǭj3{G^rXc q qM@ӦWM;/hq{`o4<\ pSg9^?k"fc4cz>ob{ۈڅW(⎗9]h?927.I xHM;vt <ȑjS]d.Q$þr  0o "cm&xa&nx P fc33?uT}*oRj/Xɉmd# 1?!Np6iPALQ\9׼Vsʞ5]mnNKRIk 7Wǃ)#9OM?ix 2{:q.oܟV$i;jȐ XuÕ>4lX7ؠ6LI3 :}7p<4Ÿ0t~ &?YWw!%Q>zA2|nt3D<|<,`X@E&]Bhޚ/!򽱿> zT J㻓Ӡ#axMMDMT->4PEF9aU?uR 8Y \lev)#gZgY`!1  }F?&zɪ 0^ s8o,*8O 3pyaw`Pkw!I"Y]HU2rg(䨵.c <ِ]s}1ZuzoB i^7KD~(@fw~r*A꜄@f_fM|fkek9OQGAfU7l$t9F,P[uUqp[ؙ`L!LNדw ۼUCޅ% ,%z7JWTL22??W,@\i)߷[βьmW>X;6@V_)5`[pwáx4WOSLΛ6èL!5)1iV v0*,2&="I@h-%` Oc^*l&SRi /#XFqsN5'.#mkp`XRv鎗$s/̸,$_i2X?̏* zk26h[[M.yod;:(;DȖe}ȶAh2ՏuG:䉒i( 7> -qRB䲵WZ|5K̡EM[+'=ô9埨ަ-M1ˀ?M^}!#,G-Xfan%qVr HquWO "bx:' &P)ۉxO5u*ncɄ]JV V~aWa`.8&~vtq5 Z/vޚpArpqODRۇ_8^oaf}&f|.N_)6DC1vsNe3GEIo舅N&Ɩ=gt!@E]&C*#|m[TD7{gs͑)g~tpף H)Yooh&6`[="Ä=X(Dql*PY4*ucYքXg8;v46|yTz2(KHU8\!ACijڒ3lυӡB1ʆK4m;!T"ɷV6@%KWcKͧsJK[*gb R$<ș"0K"*%' U;>oC;:%Z+[RAZCBw1pIRGZ1\2M-wo|ւ/m_/ ; >fqy& XT/z>UYPEE^)"OhbytDBud@Q"* ®d|V?y&/!wZdͷ~d.{zO~[h/LAWCkcra9ok >2h>~JXC;!hYzf1Dwnhm3/eԹ9g9(2T `hh>b>$nG.{X0z'?ldgaUIdYuJ~!#&STN([O)uLG#+I֞r3d! l^2te [?XHE=RyQ,d)d6vvo5Fۂ4mIOVM+0 n&Y|aw:ue 'E# YZ